KEGG   Streptococcus thermophilus JIM 8232: STH8232_1766Help
Entry
STH8232_1766      CDS       T02026                                 

Gene name
amyL
Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    STH8232_1766 (amyL)
Enzymes [BR:stu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     STH8232_1766 (amyL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1471549..1473000
Genome map
AA seq 483 aa AA seqDB search
MTNQTAMQYFEWYLPSDGQHWNNLAEDAQHLADLGISHVWMPPAFKATNKDDVGYGVYDL
FDLGEFDQKGTIRTKYGLKEEYLNAINQLKNVGIIPMADVVLNHKAAADKLETFYVVEVD
PEDRTKVISEPFEIEGWTHFTFDGRQKAYNDFEWHWYHFNGTDFDAKRNKKGIYLIQGDN
KGWAHNDLVDNENGNFDYLMFANLDYRHPEVIENIYEWADWFVETTGVQGFRMDAIKHID
YFFMRNFIRDVKEKQGQDFYVFGEFWNAKEEDNNTYLEKTENRFDLVDVRLHYNLYDASL
KGADYDLTTIFEQTLVKNHPEHAVTFVENHDTQRGQALESTVEEWFKPSAYALILLRKDG
LPCLFYGDYYGIDGEFAQESFKEVLDTLLYARKDLAYGEQTDYFDDPNCIGWTRSGNEDC
TPLAVTISNDAANNKSMEIGSDWAGQTFYDILGNCSDTVTIDEDGWGDFPVSEKSVSVWT
IQD
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcaaactgcaatgcaatactttgaatggtatctcccaagtgacggccagcat
tggaacaacttagctgaagatgcccaacatctagcagaccttggcatcagccatgtttgg
atgccacctgctttcaaagctactaacaaagatgatgttggttacggagtctatgacctc
tttgaccttggggaattcgaccaaaaaggaaccatacgcaccaaatatggtctcaaggaa
gaataccttaatgccatcaaccaactcaaaaatgttggtatcatccctatggccgatgtt
gtgctcaaccacaaggcagccgcggataaacttgaaaccttttatgtggtagaagttgac
cctgaggaccgtaccaaagtaatcagcgaaccgtttgaaatcgagggttggactcatttc
acttttgacggacgtcagaaagcttacaacgactttgaatggcactggtaccactttaat
gggactgacttcgatgccaaaagaaataaaaaaggtatctatcttatccaaggtgacaac
aaaggctgggcacataatgacttggttgacaatgaaaatggtaactttgactaccttatg
tttgccaacctagattataggcatcctgaagttatagaaaatatttacgaatgggctgac
tggttcgtcgaaacaactggtgtccaaggtttccgaatggatgccatcaagcacattgat
tatttctttatgcgtaattttattcgcgacgtcaaagaaaaacaaggtcaagatttctat
gtttttggtgaattttggaatgccaaggaagaggataataatacttatctcgaaaaaact
gaaaaccgctttgatcttgtggatgttcgccttcattacaatttatatgatgccagcctc
aaaggagcagattacgatttgacgactattttcgaacaaacattggtcaaaaatcaccct
gagcatgcggtaaccttcgtagagaaccatgacacccaacgtggacaagcattggaatct
actgttgaagaatggtttaaaccatctgcctatgccctcatccttcttcgtaaagacggc
cttccttgcctattttatggtgactactatggcattgatggtgagtttgctcaagaaagt
ttcaaagaggtcctagacaccttactttacgctcgtaaagatttggcttatggagagcaa
acagactactttgacgaccctaactgtattggatggacacgctctggtaatgaagactgt
actccattagccgtaaccatttctaatgatgctgccaacaacaaatctatggaaattgga
agtgattgggctggacaaactttctatgatattcttggaaactgctctgatactgtaaca
attgacgaagacgggtggggagacttcccagtctctgaaaaatctgtcagcgtttggaca
attcaagactaa

DBGET integrated database retrieval system