KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY2579Help
Entry
STY2579           CDS       T00064                                 

Definition
(RefSeq) glutathione-S transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Brite
Enzymes [BR:sty01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     STY2579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
GeneDB: 
UniProt: 
LinkDB All DBs
Position
2415435..2416082
Genome map
AA seq 215 aa AA seqDB search
MIDLYYAPTPNGHKIMLFLEEAELAYRLLKVDISKGNQFRPDFLAISPNNKIPAIVDHAP
ADGGQPLSLFESGEILLYLAEKSGKLLSGELRERHTTLQWLFWQVGGLGPMLGQNHHFNH
FAPQAIPYAIERYQVETQRLYNVLNKRLETSPWLGGDHYSIADIASWPWVNAHQRQRIDL
DTYPAVYNWFERIRTRPATARALLQAQLHCNSTKA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgattgacctttactacgcccccacgcccaacgggcataaaataatgctgtttctggaa
gaggcggagctggcgtatcgtttgctaaaagtagatatcagcaagggcaatcagtttcgc
cctgattttttggctatctctcccaataataaaattcctgccatcgtcgatcacgccccg
gcagacggcggtcaaccgcttagtctttttgaatccggcgaaattcttctctacctagcg
gaaaaaagcggcaaactgcttagcggggagctgcgtgaacgccataccacgctgcaatgg
ctgttctggcaggtcggcgggttagggccgatgctgggccagaatcatcactttaaccac
tttgcgccacaggccatcccctatgcgattgaacgctatcaggttgaaacgcaacgctta
tacaacgtcctgaataaacgcctggaaacctccccgtggctgggcggcgaccactacagt
attgcggatatcgccagttggccgtgggttaacgcacatcagcgtcagcgaatcgatctt
gatacttacccggcggtgtataactggtttgaacgcattcgcacgcgtcctgcgacagcg
cgcgcactgttacaagcgcaactgcactgtaacagtacgaaagcgtaa

DBGET integrated database retrieval system