KEGG   Streptococcus pyogenes Alab49 (serotype M53): SPYALAB49_000859Help
Entry
SPYALAB49_000859  CDS       T02019                                 

Definition
(GenBank) thymidine kinase family protein
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
stz  Streptococcus pyogenes Alab49 (serotype M53)
Pathway
stz00240  Pyrimidine metabolism
stz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stz00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SPYALAB49_000859
Enzymes [BR:stz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SPYALAB49_000859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK KdpD AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: AEQ24459
LinkDB All DBs
Position
838368..838937
Genome map
AA seq 189 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGFGIVSSRIGMRREAI
PISNDMDIFTFIAQLEEKPYCVLIDESQFLSKQNVYDLARVVDELNVPVMAFGLKNDFQN
NLFEGSKHLLLLADKIDEIKTICQYCSKKATMVLRTENGKPVYEGDQIQIGGNETYIPVC
RKHYFNPEI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttggctcaactctattataaatatgggacaatgaattctggtaaaaccattgaaatttta
aaagttgctcataactatgaagaacaaggcaaacctgttgtcattatgacaagtgctctt
gatacacgtgatggttttggcatcgtctcaagccgtattggtatgcgacgagaagctatt
cccatttcaaatgacatggatattttcacatttattgcccaattggaggaaaaaccttat
tgtgtcctgattgacgaaagccaatttttaagcaagcaaaatgtttatgatttggcgcgt
gtggtggatgagctaaatgttcctgtcatggcttttggtttgaaaaatgatttccaaaac
aatctttttgaaggttcaaaacatttgctattattggccgataagattgatgaaatcaaa
acaatttgccaatactgtagtaagaaagcaaccatggttttaaggacagaaaacggaaaa
cctgtctatgaaggcgatcagatacaaattggtggtaatgaaacctatatcccagtttgt
cgaaaacattattttaatccagagatttaa

DBGET integrated database retrieval system