KEGG   Sulfitobacter sp. AM1-D1: BOO69_00115Help
Entry
BOO69_00115       CDS       T04555                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
suam  Sulfitobacter sp. AM1-D1
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:suam00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BOO69_00115
   00650 Butanoate metabolism
    BOO69_00115
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BOO69_00115
   00280 Valine, leucine and isoleucine degradation
    BOO69_00115
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BOO69_00115
Enzymes [BR:suam01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BOO69_00115
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     BOO69_00115
Amino acid related enzymes [BR:suam01007]
 Aminotransferase (transaminase)
  Class III
   BOO69_00115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
21380..22657
Genome map
AA seq 425 aa AA seqDB search
MIERRNAAVARGVASAAPIYAQYAENAELWDVEGNRYIDFVGGIGVLNTGHRHPKVVAAA
KAQEDHYTHTSFQVVPYGPYIELAEKLNALAPGDAPKKTLLVTTGAEAVENAVKIARAAT
GRPGVIAFTGGYHGRTLLTLGMTGKVSPYKKGVGPFPADVFRAPFPSVRDGITVDDAITG
LKNLFLTDAEPSRVAAIIIEPVLGEGGYTPVPFEMMQQLRDICDEHGILLIADEVQAGFG
RTGTWFAVEHSGVVPDLITVAKSMAGGYPLAGVIGRADVMDAMDPGGLGGTYGGNPVACA
AALAAIEAIEEEGLLARSTAMGETLKARFSEIGARSAPYRFWDVRGLGAMVAVEFVTDFD
TAKPDADLTKRVIAHALKRGLLLLSCGMHGNAVRVMVPLTASDAVVEEGLSIFEAAVQAA
VAEEA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacgccgcaacgccgccgtcgcgcgcggcgtggcgtcggccgcgccgatctac
gcgcagtatgccgagaacgccgaactctgggacgtcgaaggcaaccgttacatcgatttc
gtcggcgggatcggcgtgctgaacaccggccaccgtcatcccaaggtcgtcgccgcggcg
aaggcacaggaagaccattacacgcacacctcgttccaggtcgttccctatggtccctac
atcgaacttgcggaaaagctgaacgcgctggcccccggcgatgcgcccaagaaaacgctt
ctggtcacgaccggggcagaggccgtggaaaacgcggttaagatcgcacgtgccgcgact
ggccgtccgggtgtgattgcctttaccggagggtaccacggccgcacgctgctgaccctc
ggcatgaccggcaaggtcagcccctacaagaagggtgtgggcccgttccccgcggatgtc
ttccgcgcgccgtttccctccgtgcgtgacggaatcaccgtcgacgacgcgatcaccggc
ctcaagaacctgttcctgaccgatgcggaaccctcccgcgtggcggcgatcatcatcgag
cccgtgttgggcgagggcggctataccccggttcccttcgagatgatgcagcaactgcgc
gacatctgcgatgaacatggcattctgctgatcgccgatgaagttcaggcgggctttggc
cgcacgggcacatggttcgctgtcgaacattccggcgtggttccggacctgatcaccgtc
gcgaagtccatggccggtggttatccgctggccggcgtgatcggccgcgccgacgtgatg
gacgcgatggatcccggtggccttggcgggacctacggcggcaacccggtcgcatgcgcc
gcggcgctggccgcgatcgaggcgatcgaggaagaaggcctgctggcccgttccaccgca
atgggcgagaccctcaaggcgaggttcagcgagatcggcgcgcggtccgcaccctaccgg
ttctgggacgtgcgcggacttggcgcgatggtcgcggtcgagttcgtcacagacttcgac
accgccaagccggacgccgatttgacgaagcgggtgatcgcgcatgcgctcaagcgcggg
ctgctgctgctgagctgtggcatgcacgggaacgccgttcgcgtcatggtgccgttgacc
gcttccgatgccgtggtcgaggagggtctgtccatcttcgaagcggccgtgcaggccgcc
gtcgccgaagaggcctga

DBGET integrated database retrieval system