KEGG   Streptococcus uberis: SUB0602Help
Entry
SUB0602           CDS       T00849                                 

Gene name
ppc
Definition
(GenBank) putative phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sub  Streptococcus uberis
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sub00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SUB0602 (ppc)
  Energy metabolism
   00680 Methane metabolism
    SUB0602 (ppc)
Enzymes [BR:sub01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SUB0602 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
566903..569611
Genome map
AA seq 902 aa AA seqDB search
MAVKKLESSSNQAIIAEEVAILKTILETITRDMVGDETFLKIEQIVKLSEQDDYIQLEKM
IESLTDDEMVIMSRYFSILPLLINISEDVDLAYEINFQNNKGINYLGKLSHTIEEVASKE
NAKDILENVTVVPVLTAHPTQVQRKTVLELTNKIHGLLRQYRDVKSGVINEEKWLEELRR
YVEIIMQTDIIREKKLKVKNEITNVMAYYHSSIIPAVTRLTLAYKELAKEKGLELENPKP
ITMGMWIGGDRDGNPFVTAETLQLSASIQSQVIIEYYLEKLSKLYRSLSLSSRFSKTSKA
LDDLAALSSDTSIYREHEPYRKAFHYIQSKMSNTLTSIKENASHDKQPSDIYETAEDFKK
DLLIIKDSLVQNGEGTLISGDFSDLLQAVDVFGFFLASIDMRQDSSVQEACVAELLKSAN
IVDDYSALNETEKCQILLKELEEDPRILSATAVEKSELLEKELAIYKAARYLKDKLGEDV
IKQHIISHTESVSDMFELAIMLKEVGLLDKHMARVQIVPLFETIEDLDNSNAIMTEYLSY
DIVKNWIASNHNYQEIMLGYSDSNKDGGYLASGWTLYKAQNELTEIGSKNGIKITFFHGR
GGTVGRGGGPSYDAITSQPFGSIKDKIRLTEQGEIIENKFGNKDAAYYNLEMLISASINR
MVSRMLTNPNEIDGFRETMEGIVSYSNKVYRDLVFDNPNFYDYFFEASPIKEVSSLNIGS
RPAARKTITEITGLRAIPWVFSWSQNRIMFPGWYGVGSAFKDFIDKEEGNLAKLQHMYKT
WPFFHSLLSNVDMVLSKSNMNIAYQYAQLANTQEVKDIYYILLDEWQLTKNIILAIENHD
ELLEDHPSLKHSLEFRLPYFNILNYIQIELIKRLRQNQLGEGYEKLIHTTINGIATGLRN
SG
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
ttggctgtgaaaaaattagagagtagtagtaatcaggcaattattgctgaggaagttgcg
attttaaaaactattttagaaacaatcacccgtgacatggttggggatgagaccttttta
aaaattgagcaaattgtaaaactctcagaacaagatgattacattcaacttgaaaaaatg
attgaatccttgactgatgatgagatggttattatgtctcgttatttttcaattttgcca
ttgctgatcaatatctctgaagatgttgatttagcatatgagataaattttcaaaataat
aaaggaatcaattatcttggtaaattgtctcataccattgaagaagttgcttccaaagaa
aatgcaaaggacattttggagaacgttacagtcgttcctgttttaacagcacacccaacg
caagttcaacgcaaaaccgttttggaattaactaataaaattcatggcctcttaaggcag
tatcgcgatgtcaaatctggcgttatcaatgaagaaaaatggttagaagaattacgtcgt
tacgttgaaatcatcatgcagacagatatcattcgtgaaaagaaacttaaagttaaaaat
gaaatcaccaatgttatggcatattatcattcatcgatcattccagcggttactcggtta
acacttgcttataaagaattagcaaaagaaaaagggcttgaattagaaaatccgaaaccg
attacaatgggaatgtggattggtggcgatcgtgatggcaatccatttgtaacagctgaa
acgctccaattatctgcttcaattcagagtcaggtaatcattgaatactatttagaaaag
ttatctaaattataccgttcattgtcattatcttctcgtttttcaaaaaccagcaaagct
ctggacgacttagcggcactatcaagtgatacttcgatatatagggaacacgaaccttat
cgcaaagctttccactatattcagtcaaaaatgtcaaatactttaaccagtatcaaagag
aatgcatcacatgataaacagccttctgatatctatgagacagcagaagacttcaaaaaa
gacttgttgattattaaagattctcttgttcaaaatggcgaaggaacacttatctcggga
gatttttcagacttactccaagctgttgatgtttttggtttcttcctagcaagtattgat
atgagacaggattcaagtgttcaagaggcttgtgtggctgaattgcttaaatcggcaaat
attgtggacgattatagtgcattaaacgaaactgaaaaatgtcaaatacttcttaaggaa
ctcgaagaagacccccgtatactttcagcaaccgctgttgaaaaatcagaattactagaa
aaagaattagcaatctataaagcagctcgttatcttaaagataaattgggtgaagatgtt
attaaacagcatatcatttcacatactgaaagtgtttcggatatgtttgagttggcaatt
atgcttaaagaagtggggcttttggataaacatatggcgcgtgttcagattgtaccactc
tttgaaacgattgaggatttggacaattcaaatgccattatgacagagtacttgagttat
gatattgtcaaaaattggattgcatctaatcacaactatcaagaaattatgttaggctat
tccgatagtaataaagatggaggctatttagcttcggggtggactttatacaaagcgcaa
aatgaactgaccgaaattggatcaaaaaatggaatcaaaattactttcttccatggtaga
ggtggtacggttggacgtggtggaggtccatcatatgatgccattacatcacaaccattt
ggttcaataaaagataaaattcgtctaacagaacaaggcgaaatcattgagaataaattt
ggaaataaagacgccgcttactataatttggaaatgcttatttcagcgtctattaataga
atggtgtctagaatgttgactaatccaaatgaaattgatggctttagagaaactatggaa
ggtattgtttcctatagtaataaagtataccgtgatttagtttttgacaatccaaacttt
tatgattatttctttgaagctagtccgattaaagaagtttctagtttaaatattgggtca
agaccagcggctcgtaaaaccataactgaaatcacaggtttaagagccatcccttgggta
ttctcatggtctcaaaacaggataatgttccctggttggtatggtgtaggatctgctttt
aaagattttattgataaagaagaaggtaatttagctaagcttcaacacatgtataaaact
tggccatttttccactcccttttatcaaatgtcgatatggtgctttctaagtctaacatg
aatattgcttatcaatatgctcaacttgcaaatactcaagaagtcaaagatatttactat
attcttttggatgaatggcaattgactaaaaatatcattttagcaattgaaaatcatgat
gagctattggaagaccatccttcattgaaacatagtttggaatttagattaccttatttc
aatatcttaaattatattcaaattgagttgataaaacgcctaagacaaaaccaattaggt
gaaggatacgaaaaattaatccatacaacaatcaatggaattgctactggattacgtaat
tctggttaa

DBGET integrated database retrieval system