KEGG   Staphylococcus argenteus: SAMSHR1132_15490Help
Entry
SAMSHR1132_15490  CDS       T01767                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
suh  Staphylococcus argenteus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAMSHR1132_15490
   00030 Pentose phosphate pathway
    SAMSHR1132_15490
   00051 Fructose and mannose metabolism
    SAMSHR1132_15490
   00052 Galactose metabolism
    SAMSHR1132_15490
  Energy metabolism
   00680 Methane metabolism
    SAMSHR1132_15490
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SAMSHR1132_15490
Enzymes [BR:suh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SAMSHR1132_15490
Protein phosphatases and associated proteins [BR:suh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SAMSHR1132_15490
Messenger RNA biogenesis [BR:suh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SAMSHR1132_15490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1706240..1707208)
Genome map
AA seq 322 aa AA seqDB search
MKKIAVLTSGGDSPGMNAAVRAVVRTAIYNEIEVYGVYHGYQGLLNDDIHKLELGSVGDT
IQRGGTFLYSARCPEFKEQEVRKVAIENLRKRGIEGLVVIGGDGSYRGAQRISEECKEIQ
TIGIPGTIDNDINGTDFTIGFDTALNTIIGLVDKIRDTASSHARTFIIEAMGRDCGDLAL
WAGLSVGAETIVVPEVKTDIKEIADKIEQGIKRGKKHSIVLVAEGCMTAQECQKELSEYI
NVDNRVSVLGHVQRGGSPTGADRVLASRLGGFAVDLLMEGETAKGVGIKNNKIVATSFDE
IFDGKDHKFDYSLYELANKLSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattgcagttttaacaagtggtggagattcacctggaatgaatgctgccgta
agagcagttgttcgtacagcaatttacaacgaaattgaagtttatggtgtgtatcatggt
tatcaaggattgttaaatgatgatatccataagcttgaattaggttcagttggggatacg
attcaacgtggaggtacattcttgtattcagcaaggtgtccagagtttaaagaacaagaa
gtacgtaaagttgctattgaaaacttacgtaaaagaggcattgaaggacttgtagttatt
ggtggagacggtagttatcgaggagcgcaacgcattagtgaagaatgcaaagaaattcaa
actatcggtattcctggtacgattgacaatgatatcaatggtactgattttacaattgga
ttcgacacagcattaaacacaattattggtttagtagataaaattagagacactgcatca
agtcatgctcgaacgtttatcattgaagctatgggacgtgattgtggagacttagcattg
tgggctggattatcagtaggtgctgaaacaattgtagtaccagaagtgaaaacagatatt
aaagaaatagctgataaaattgaacaaggtattaaacgcggtaaaaaacactcaatcgtt
cttgtagctgaaggatgtatgacagcgcaagagtgccaaaaagaattatcagaatacatt
aatgtcgataatagagtttctgttttaggtcacgttcaacgtggtggtagtccgacaggt
gcggatagagtattagcatcacgtttaggtggttttgctgtagacttattaatggaaggt
gaaacagctaaaggtgtcggtattaaaaataataaaatagtagcgacatcatttgatgaa
attttcgatggtaaagaccataaatttgattatagcctatacgaacttgctaacaagtta
tctatataa

DBGET integrated database retrieval system