KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_1258Help
Entry
SYO3AOP1_1258     CDS       T00715                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Brite
Enzymes [BR:sul01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SYO3AOP1_1258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1303666..1304400
Genome map
AA seq 244 aa AA seqDB search
MDRRDFIKLSGISILASSTNILAMEILEKEEKPKSGGKKMKVMKLQPKDHLKPKGLVGIS
DEQIEVHFEAHYKGYVAKYNEIQEKLASNFADRSKANQNYSEYRALKVEESFNYMGVILH
ELYFENLIGGGKGEPSEQLRKAIEEWFGSVDNCLNEIKATGIACRGWATLSYDLYNKMLF
VNGFDAHNQYGFVGSIPLIVLDVYEHAYYVDQKNKRPPYIDAFFKNLNWDVINQRFENAL
KVKV
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggacagaagagattttattaaattgtcgggaatcagtattttagcttcaagcacaaat
attttagcaatggaaattttagaaaaagaagaaaaacctaaatcaggaggtaagaaaatg
aaagttatgaaacttcagccaaaggaccatttaaaaccaaaaggtcttgtaggaatatca
gatgagcaaattgaggttcattttgaagctcattacaaaggttatgtagcaaaatacaat
gaaattcaagagaagttagcatctaattttgcggacaggtctaaggctaatcaaaactac
tctgaatacagagctcttaaagttgaggaaagctttaactatatgggggttattttacat
gaactttattttgaaaacttaatcggtggtggaaaaggtgagccaagcgaacagcttaga
aaagctatagaagaatggtttggttcggttgataactgcttaaatgaaattaaagctaca
ggtatagcatgcagaggttgggctactttatcttatgatttgtacaacaaaatgttattt
gtaaacggttttgatgctcacaatcaatatgggtttgttggctctattccattgatagtt
ctggatgtatacgaacatgcttattatgtagaccaaaaaaataaaagaccaccatatatt
gatgcatttttcaaaaatcttaactgggatgtgatcaatcagagatttgaaaatgcttta
aaagtaaaagtttaa

DBGET integrated database retrieval system