KEGG   Sulfuriferula sp. AH1: CAP31_02185Help
Entry
CAP31_02185       CDS       T04857                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sulf  Sulfuriferula sp. AH1
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sulf00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CAP31_02185
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CAP31_02185
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CAP31_02185
Enzymes [BR:sulf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CAP31_02185
Peptidoglycan biosynthesis and degradation proteins [BR:sulf01011]
 Precursor biosynthesis
  Amino acid ligase
   CAP31_02185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
425738..426649
Genome map
AA seq 303 aa AA seqDB search
MSRFGKVGVLLGGRSAEREVSLNSGHAVLAALQRQGVDAHAFDPAEQDLAALAAQGFDRV
MISLHGRFGEDGTVQGALDLMDIPYTGSGVMASALAMDKWRTKLLWQAAGVPTPDYALLD
EHTDFDAVVARLGLPIFVKPAREGSSIGMSKVTQADELRAAWEKAAQFDALVLAEQFIEG
GEYTCAILGDKALPMIRLVPKKAFYDFEAKYLRDDTEYRVPCGLATEQEQSIQRLAKKAF
DVLGCRGWARLDVMLDAAGTPYFLEANTSPGMTDHSLVPMAARAAGMTFDELVLAILEQA
RVG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgatttggaaaagtgggtgtgttattgggcgggcgctcggctgaacgcgaggtg
tcgctgaacagcggccatgcggtgctggccgcgttgcaacgccagggcgtggatgcgcat
gccttcgaccccgccgagcaggatctggcagcattggcagcgcagggttttgatcgggtc
atgatctcgctgcatggccgcttcggcgaagacggtaccgtacagggcgcgctcgatttg
atggatatcccttataccggcagcggggtgatggcgtcggcgctggcgatggacaaatgg
cgcaccaaattgttgtggcaggcggcaggcgtgccgacgccggattacgcattgctggat
gagcataccgattttgatgcggtcgtggcgcggctgggattgccgatcttcgtgaaaccg
gcgcgtgaaggttccagtatcggcatgagcaaagtgacgcaggcggacgaattgcgcgca
gcgtgggaaaaggcggcgcagttcgatgcgctggtgctggccgagcagtttatcgaaggc
ggcgaatatacctgcgcgatcctcggtgacaaggcgttgccgatgatacggctggtgccg
aagaaggcattttacgattttgaagccaaatacttgcgcgacgacacggaataccgggtc
ccttgcgggctggcgacggagcaggagcagtcgatacagcgcctcgccaaaaaagccttc
gatgtgctgggctgtcgcggctgggcgcggctggatgtgatgctggatgcagcgggcacc
ccgtactttctggaggcgaatacgtcgccgggcatgaccgatcacagtctggtgccgatg
gcggcgagggcggcagggatgacattcgacgagctggtattggcaatattggagcaggcc
cgtgtgggatga

DBGET integrated database retrieval system