KEGG   Stigmatella aurantiaca: STAUR_3537Help
Entry
STAUR_3537        CDS       T01425                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sur  Stigmatella aurantiaca
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    STAUR_3537 (gabT)
   00650 Butanoate metabolism
    STAUR_3537 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STAUR_3537 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STAUR_3537 (gabT)
Enzymes [BR:sur01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     STAUR_3537 (gabT)
Amino acid related enzymes [BR:sur01007]
 Aminotransferase (transaminase)
  Class III
   STAUR_3537 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4258475..4259746
Genome map
AA seq 423 aa AA seqDB search
MSDNNVNLLRRKDAATPRGVGVMAPFFVSRAENSELWDVEGRRFIDFAGGIAVLNTGHRH
PRVVEAVKAQLDAFTHSAYQIVPYEAYVRLAERLNRLTPGAFAKKTTFFSTGAEAIENAV
KIARSATGRSGIIAFSGGFHGRTMMGLALTGKVVPYKAGFGPFPPEVYHVPFPIALHGIS
VEDTLRAFQNLFKADIEPKRVAAILIEPVQGEGGFYVAPPELMRSLRKLCDEHGILLIAD
EVQTGFARTGKWFAMDHHDVHPDLIVTAKSLAGGFPLSAVTGRAEVMDAPEPGGLGGTYA
GNPLAIAAANAVLDIIEDEGLVKRANELGDVLRIKLEGLKAKVPQMAEVRGLGAMLAVEF
CQPGGHTPDTEFTKVVKARALEKGLMLLTCGVYSNVIRFLFPLTVPEPVFKEGLSILESA
LTG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaacaacgtcaacctgctgcgccgcaaggatgccgccacaccgcgaggggtg
ggggtgatggcgccttttttcgtctcccgcgcggagaacagtgagttgtgggacgtggag
ggccgccgcttcatcgacttcgcgggcggcatcgcggtgctcaacacggggcatcgccac
cctcgggtggtcgaggcggtgaaggcccagctcgatgccttcacgcacagcgcctaccag
atcgtcccctacgaggcctacgtgcggctggccgagcggctcaaccggttgacgccgggg
gcgttcgccaagaagacgaccttcttctccacgggggccgaggccatcgagaacgcggtg
aagatcgcccgttcggccacgggccgcagcggcatcatcgccttcagcggggggttccac
ggccggacgatgatgggcctggcgctcaccggaaaggtggtgccgtacaaggcaggcttc
gggccttttccgccggaggtctaccatgtgccctttccgatcgccctgcacggcatcagc
gtggaggacacgctccgggcgtttcagaacctcttcaaggcggacatcgagcccaagcgg
gtggcggccatcctcatcgagccggtgcagggagagggcggcttctacgtggcgcccccc
gagctgatgcggagcctgagaaagctgtgcgacgagcacggcatcctgctcattgccgat
gaggtgcagaccggcttcgcgcgcacggggaagtggttcgcgatggaccaccacgatgtg
catccggacctgatcgtgacggccaaatccctggcgggagggttccccctgtcggcggtg
acgggccgggcggaggtgatggatgcaccggagccaggtgggctcggaggcacctacgcg
ggcaaccccctggcgatcgcggcggcgaacgcggtgctggacatcatcgaggacgaaggc
ttggtgaaacgggccaacgaactgggggacgtcctgcgcatcaagctggaggggttgaag
gcgaaggtgccccagatggcggaagtgcgggggctgggggccatgctggcggtggagttc
tgccagccgggcggccatacgcctgacacggagttcaccaaggtggtgaaggccagggcc
ttggagaaggggctgatgctgctgacgtgcggcgtctactccaacgtcatccgcttcctc
ttcccactgacggtgcccgagccggtgttcaaggaggggctgtccatcctggagtccgcg
ctgacggggtag

DBGET integrated database retrieval system