KEGG   Stigmatella aurantiaca: STAUR_4050Help
Entry
STAUR_4050        CDS       T01425                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00020  Citrate cycle (TCA cycle)
sur00480  Glutathione metabolism
sur01100  Metabolic pathways
sur01110  Biosynthesis of secondary metabolites
sur01120  Microbial metabolism in diverse environments
sur01130  Biosynthesis of antibiotics
sur01200  Carbon metabolism
sur01210  2-Oxocarboxylic acid metabolism
sur01230  Biosynthesis of amino acids
Module
sur_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sur_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    STAUR_4050 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    STAUR_4050 (icd)
Enzymes [BR:sur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     STAUR_4050 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ADO71836
UniProt: Q08SI8
LinkDB All DBs
Position
4906991..4908286
Genome map
AA seq 431 aa AA seqDB search
MAPPSGEKITLQSGKLHVPNNPIIPYIEGDGTGRDIWRASQAVFDAAVEKAYQGKKKISW
YEVLAGEKSFKQVNNWLPDETVEAFRSYLVGIKGPLTTPVGGGIRSLNVALRQLLDLYVC
LRPVRYFKGVPSPVKAPEKVDMVIFRENTEDIYTGIEFEAGTAAADKFLGLLKQEFEKEF
KKIRFPSNVGIGIKPVSKEGTDRLVRAAIQYAVEHKRKSVTLVHKGNIMKFTEGAFRKWG
YELAAREFGDKVYTWDQWEATKAAKGEDAANAEQKAAVSAGKIIIKDSIADITLQQVLTR
PDEFDVIATLNLNGDYLSDALAAQVGGIGIAPGGNINYVSGHAVFEATHGTAPKYADQDK
VNPGSVILSGEMMFRHLGWNEAADLIIKGMDRAIAAKTVTYDFARLMKLEGQGTVTEVKC
SEFGQAIIKHM
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctccatctggcgagaagatcacccttcagagcggcaagcttcacgtgccgaac
aacccgatcatcccctacatcgagggcgatggaaccggccgtgacatctggcgtgcctcc
caggccgtcttcgacgcggcggtggagaaggcctaccagggcaagaagaagatctcctgg
tacgaggtgctggcgggcgagaagtccttcaagcaggtcaacaactggctgccggacgag
accgtcgaggccttccgctcctatctggtgggcatcaagggcccgctgaccacgccggtg
ggcggcggtatccgctcgctgaacgtggcgctgcgccagctgctggacctgtacgtgtgc
ttgcgccccgtgcgctacttcaagggcgtgcccagcccggtgaaggcgccggagaaggtg
gacatggtgatcttccgtgagaacacggaggacatctacacgggcatcgagttcgaggcg
ggcaccgccgcggcggacaagttcctcggcctgctcaagcaggagttcgagaaggagttc
aagaagatccgcttccccagcaacgtgggcatcggcatcaagcccgtctccaaggagggc
accgaccggctcgttcgcgccgccatccagtacgcggtggagcacaagcgcaagagcgtc
acgctggtgcacaagggcaacatcatgaagttcaccgagggcgccttccgcaagtggggc
tacgagctggccgcccgcgagttcggtgacaaggtctacacctgggatcagtgggaggcc
accaaggccgccaagggcgaggacgccgccaacgccgagcagaaggccgccgtctccgcc
gggaagatcatcatcaaggactccatcgcggacatcaccctgcagcaggtgctgacccgt
ccggacgagttcgacgtcatcgccacgctgaacctcaacggcgactacctctcggacgcg
ctggccgcgcaggtgggcggcatcggcatcgcgccgggcggcaacatcaactacgtctcc
ggccacgccgtcttcgaggccacccacggcaccgcgcccaagtacgcggaccaggacaag
gtgaaccccggctccgtcatcctctccggcgagatgatgttccgccacctgggctggaac
gaggccgcggacctcatcatcaagggcatggaccgggccatcgcggccaagacggtgacg
tatgacttcgcccgcctgatgaagctcgagggccagggcaccgtgaccgaggtgaagtgc
tccgagttcggtcaggccatcatcaagcacatgtag

DBGET integrated database retrieval system