KEGG   Candidatus Solibacter usitatus: Acid_4844Help
Entry
Acid_4844         CDS       T00412                                 

Definition
(GenBank) Peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sus  Candidatus Solibacter usitatus
Brite
Enzymes [BR:sus01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Acid_4844
Peptidases [BR:sus01002]
 Metallo Peptidases
  Family M2
   Acid_4844
Exosome [BR:sus04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Acid_4844
CD molecules [BR:sus04090]
 Proteins
  Acid_4844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(6118218..6120002)
Genome map
AA seq 594 aa AA seqDB search
MKTLAVALFCAALAFAADPKATAEEARKFINDAEQKLLTLGVDSQRADWVKSTFITDDTE
LLAAMLDEKAINATVDYAKKSTRFDGLKLDPVTERKIKLLKLSLTIATPADARESEELTR
ITSSMEGAYGKGKYCPAGPDSCKDLEQLSKILAESRDPAALKEAWTGWHAIAKPIRKDFV
RYVDLANKGARELGFKDNGAMWRAKYDMSPDEFARELDRLWEQVKPLYLSLHAYVRNRLH
EKYGDVVPANGAIPADLLGNMWAQDWDNIYPLIAPPNADPGYDLSELLKRRSVDWKQMVK
YGEGFFTSLGFDPLPATFWERSLFLKPRDRDVVCHASAWDIDTESDVRLKMCLQITGEDF
LTVHHELGHNFYQLAYRKQPPLFRDSANDGFHEAVGDTIALSITPEYLVKLGLLDKAPDP
SQDIGLLLHKALEKIAFLPFGLVIDQWRWKVFAGEITPDKYNQTWWQLRQKYQGIAPPVD
RSESDFDPAAKYHVAANVPYMRYFLADILQFQFHRALSQAAGCTGPLNRCSIYGNKAAGD
RLNAMLSMGASRPWQEALEKIAGTRQMDATAIRDYFAPLQKWLDAQNKGKPVGW
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgaagactctcgccgtcgccctcttctgcgccgccctcgccttcgccgccgaccccaag
gctaccgccgaagaagcccgcaaattcatcaacgacgccgaacaaaaactcctcaccctt
ggcgtcgattcccaacgcgccgactgggtcaagtccaccttcatcaccgacgacaccgag
ctcctcgccgccatgctcgacgaaaaggccatcaacgctaccgtcgactatgccaagaaa
tctacccgctttgatggcctcaaactcgatcccgtcaccgaacgcaaaatcaaactcctc
aagctctccctcactatcgccacccccgccgacgcccgcgaaagcgaggaactcacccgc
atcacctcctccatggaaggcgcctatggcaagggcaaatactgccccgccggtcccgat
agctgcaaggatctcgaacagctcagcaagatcctcgccgagagccgcgaccccgccgca
ctcaaggaagcctggaccggctggcacgccatcgccaaacccatccgcaaggatttcgtc
cgctacgtcgatctcgccaacaaaggcgcccgcgaactcggcttcaaggacaacggcgcc
atgtggcgcgccaaatacgacatgtcccccgacgaattcgcccgtgagctcgatcgccta
tgggaacaggtcaagcccctctacctctcgctccacgcctacgtccgcaatcgcctccac
gaaaaatacggcgacgtcgtgcccgccaacggcgccatccccgccgacctcctcggcaac
atgtgggcccaggattgggacaacatttatcccctcatcgcgccccccaatgccgacccc
ggctacgatctctccgagctcctcaaacgccgcagcgtcgattggaagcagatggtcaaa
tacggtgagggcttcttcacatccctcggtttcgatcccctccccgccacattttgggaa
cgctcgctcttcctcaaaccccgcgaccgcgatgtcgtctgccacgccagcgcctgggat
atcgataccgaaagcgacgtccgcctcaaaatgtgcctccagattaccggcgaggacttc
ctcaccgtccatcacgaactcggccacaatttctatcagctcgcctaccgcaaacagccg
cctctcttccgcgacagcgccaatgatggtttccacgaagccgtcggcgacaccatcgct
ctctccatcactcccgagtacctcgtcaaactcggcctcctggacaaagcccccgatccc
tcccaggacatcggcctcctcctccacaaagccctcgagaaaatcgccttcctccctttc
ggcctcgttatcgatcagtggcgctggaaagtcttcgccggagaaatcacgcccgacaaa
tataaccagacatggtggcaactccgccagaaataccagggcatcgcgccgcccgtggac
cgcagcgagtccgatttcgatcccgccgccaaataccacgtcgccgccaacgtcccctac
atgcgctatttcctcgcggacatcctccagttccagttccaccgcgccctctcccaggcc
gcgggttgcaccggtcccttaaatcgctgctccatctacggcaacaaggccgcaggcgac
cgcctcaacgccatgctctccatgggtgccagccgcccctggcaggaggccctcgaaaaa
atcgccggcacccgccagatggacgccaccgccatccgcgactacttcgcccccctccaa
aaatggctcgacgcccaaaataaaggaaagcccgtgggctggtaa

DBGET integrated database retrieval system