KEGG   Streptomyces violaceusniger: Strvi_0343Help
Entry
Strvi_0343        CDS       T01602                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
svl  Streptomyces violaceusniger
Pathway
svl03030  DNA replication
svl03410  Base excision repair
svl03420  Nucleotide excision repair
svl03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:svl00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Strvi_0343
   03410 Base excision repair
    Strvi_0343
   03420 Nucleotide excision repair
    Strvi_0343
   03430 Mismatch repair
    Strvi_0343
Enzymes [BR:svl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Strvi_0343
    6.5.1.6  DNA ligase (ATP or NAD+)
     Strvi_0343
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Strvi_0343
DNA replication proteins [BR:svl03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Strvi_0343
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Strvi_0343
DNA repair and recombination proteins [BR:svl03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Strvi_0343
   NER (nucleotide excision repair)
    Other NER factors
     Strvi_0343
   MMR (mismatch exicision repair)
    Other MMR factors
     Strvi_0343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N RNA_ligase EII-Sor
Motif
Other DBs
NCBI-ProteinID: AEM80131
UniProt: G2PB79
LinkDB All DBs
Position
complement(112748..114286)
Genome map
AA seq 512 aa AA seqDB search
MLLADVALTSRQVAATSARSEKIAALARLFRRTEPAEAAVVITYLAGKLPQRRTGVGWST
LRHRQEPAAEPTLAVLDVDEALTRVAAVSGTGATAARKRLVGELLAAATKEEQGFLLGLI
GGELRQGALEGLAVEGLAQAVGAPAAEVRRAVMVGGSLGTVAEALLARGPEALAGFRLEV
GRPVLPMLAQSAKDLDEAIDRLGPCAVEEKLDGIRVQVHRDGEDVRIYTRTLDEITDRLP
EVVTAARELAVDRAILDGEVILLDGEGRPRPFQETSARVGSRLDVAGASAALPLSPVFFD
LLVVDDRDLLDLPARERHAELARIAPGPRRVRRLVTDDPADPETRRAAREFAADVLARGH
EGVLVKALEAPYGAGRRGASWLKVKPVHTLDLVVLAAEWGHGRRTGKLSNLHLGARAADG
TYLMLGKTFKGLTDAMLEWQTQALLGIAVSDDGWVVRVRPELVVEVAFDGLQRSSRYPAG
VTLRFARVLRYREDKPADQADTVEAVLALRGE
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggctgatgtcgcgctgacctcccgccaggtcgcggccacctccgcccgctcg
gagaagatcgccgcactggcccggctgttccggcgtacggaaccggccgaggcggccgtg
gtgatcacctacctggcgggcaaactgccccagcgccggaccggagtgggctggtccacc
ctgcgccaccggcaggaacccgccgccgagccgacgctcgcggtgctcgatgtggacgag
gccctcacccgggtcgcggcggtctccggcaccggcgcgacggcggcccgcaagcggctg
gtgggcgagctgctggccgccgcgaccaaggaggagcagggctttctgctcgggctgatc
ggcggggagctgcggcagggggccctggaagggctggccgtcgaggggctcgcccaggcc
gtgggcgcaccggccgccgaggtgcggcgggcggtgatggtcggcggttcgctgggcacc
gtcgccgaggcgctgctggcgcgcggcccggaggcgctggccggcttccggctcgaagtg
gggcggccggtgctgccgatgctcgcgcagagcgccaaggacctcgacgaggccatcgac
cggctgggaccgtgcgcggtcgaggagaagctggacgggatccgggtccaggtgcaccgg
gacggcgaggacgtacggatctacacccgcaccctcgacgagatcaccgaccggctgccg
gaggtcgtcacggcggcacgggaactggcggtggaccgggcgatcctcgacggtgaggtg
atcctgctggacggcgaggggcggccacggccgttccaggagacctccgcccgggtcggc
tcccggctcgatgtggccggggcgtcggccgcgctgccgctgtcccccgtcttcttcgat
ctgctcgtcgtggacgaccgcgatctgctcgacctgccggcccgcgagcgccatgccgaa
ctcgcccggatcgcccccgggccccggcgggtgcggcggctggtgaccgacgacccggcg
gatccggaaacccggcgggcggcacgggagttcgccgccgacgtgctggcccgggggcat
gagggggtgctggtcaaggcgctggaggcgccgtacggcgcgggccggcgcggggcgtcc
tggctgaaggtcaaaccggtgcacacgctggacctggtggtgctggcggcggagtgggga
cacggccgccgcaccgggaagctgtccaacctgcacctgggcgcgcgagcggcggacggc
acgtatctgatgctgggcaagaccttcaaggggctcaccgacgcgatgctggagtggcag
acgcaggcgctgctggggatcgcggtcagcgacgacggctgggtggtgcgggtgcggccg
gagctggtggtggaggtggccttcgacgggctgcagcgctcgtcccgctatccggcgggc
gtcacactgcggttcgcgcgggtgctgcgctaccgggaggacaagccggcggatcaggcg
gacacggtcgaggcggtgctggcgctgcgcggcgagtga

DBGET integrated database retrieval system