KEGG   Streptomyces violaceusniger: Strvi_1610Help
Entry
Strvi_1610        CDS       T01602                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
svl  Streptomyces violaceusniger
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Strvi_1610
  Amino acid metabolism
   00310 Lysine degradation
    Strvi_1610
   00380 Tryptophan metabolism
    Strvi_1610
Enzymes [BR:svl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Strvi_1610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1479892..1483737)
Genome map
AA seq 1281 aa AA seqDB search
MSPQSPNTSSVSTDEQDGQGSNPAAAFGPNEWLVDEIYQQYLQDPNSVDRAWWDFFADYK
PGQDTGSAVAKPPQGVAASAAPAAPAQPAEAKPAVPAAKPAEAKPAAAAPAAPKPAPAQP
AAPAAKAAPTAPAAPAKPAPVKPTPAEPTVSKKEPAGPSVGPELVTLRGPSAAVAKNMNA
SLELPTATSVRAVPVKLLFDNRIVINNHLKRARGGKVSFTHLIGYAMVQALKAMPSMNNS
FTEKDGKPTLVKPEHINLGLAIDLVKPNGDRQLVVAAIKKAETLNFFEFWQAYEDIVRRA
RSGKLTMDDFTGVTASLTNPGGIGTVHSVPRLMPGQGLIVGVGAMEYPAEFQGTSQDTLN
KLGISKVMTLTSTYDHRVIQGAASGEFLRIMNQLLLGENDFFDEIFKALRIPYEPVRWLK
DIDVSHDDDVTKAARVFDLIHSYRVRGHVMADTDPLEYRQRKHPDLDIIEHGLTLWDLER
EFAVGGFAGKTMMKLRDILGVLRDSYCRTTGIEFMHIQDPKQRKWIQDRVERNHDKPERE
EQLRILRRLNAAEAFETFLQTKYVGQKRFSLEGGESVIPLLDAVLDAAAESRLDEVVVGM
AHRGRLNVLANIVGKSYAQIFREFEGNLDPKSMHGSGDVKYHLGAEGTFTGLDGEQIKVS
LAANPSHLEAVDPVLEGVVRAKQDIIGKAGTDFTVLPVALHGDAAFAGQGVVAETLNMSQ
LRGYRTGGTVHIVINNQVGFTAAPAASRSSMYATDVARMIEAPIFHVNGDDPEAVVRVAR
LAFEFRQAFNKDVVIDLICYRRRGHNETDNPGFTQPLMYDLIDKKRSVRKLYTESLIGRG
DITLEEAEQALQDFQGQLEKVFTEVRDAVSAPAPAEVPEPQAEFPVTVQTAVSQEVVKRI
AESQVNTPDRITVHPRLFPQLQRRAAMIEDDSIDWGMGETLAIGSLLMEGTPVRLAGQDS
RRGTFGQRHAVLVDRETGDDYTPLLYLTEDQARYNIYDSLLSEYAAMGFEYGYSLARPNA
LVMWEAQFGDFVNGAQTIVDEFISSAEQKWGQTSGVTLLLPHGYEGQGPDHSSARIERFL
QLCAQNNMTVAAPTLPSNYFHLLRWQVHNPHHKPLVVFTPKSMLRLKAAASRTDEFLNGS
FRPVIGDETVDPAAVRKVVFCSGKVYYDVAAERDKRGANDTAIIRLERLYPLPGTELQAE
IAKYSGVEKFVWAQEEPANQGAWPFVALNLIDHLELSVGADVPAAERLVRVSRPHSSSPA
VGSNKRHQSEQQALVNEIFEI
NT seq 3846 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgccacagtcccccaacacctcgagcgtctcgaccgatgaacaggacgggcaggga
agtaaccctgccgctgccttcggccccaatgagtggctcgtcgacgagatctaccagcag
tacctccaggacccgaactcggtcgaccgagcctggtgggacttcttcgccgactacaag
ccgggtcaggacaccggctccgcggtggccaagccaccacagggagtagccgcgagcgcc
gccccggcggctccggcccagccggcggaggccaagcccgccgtcccggccgcgaagccc
gccgaggccaagcccgccgcggcggccccggccgccccgaagcccgcaccggcgcagccc
gcggcccccgccgcgaaggccgccccgacggctccggcggccccggccaagcccgctccg
gtcaagccgactccggccgagccgacggtctccaagaaggagcccgccgggccgtccgtc
ggccccgagctggtcacgctgcgcggcccctccgccgccgtggcgaagaacatgaacgcg
tcgctggagctgccgacggccacctcggtccgcgcggtcccggtcaagctgctgttcgac
aaccgcatcgtcatcaacaaccacctcaagcgcgcccgcggcggcaaggtgtccttcacg
cacctgatcggctacgccatggtgcaggcgctgaaggcgatgccctcgatgaacaattcg
ttcaccgagaaggacggcaagccgaccctggtcaagcccgagcacatcaacctcggtctc
gccatcgacctggtcaagcccaacggtgaccgccagctcgtcgtggccgcgatcaagaag
gccgagacgctcaacttcttcgagttctggcaggcgtacgaggacatcgtgcgccgcgcc
cgctcgggcaagctgacgatggacgacttcaccggcgtgacggcctccctgaccaacccc
ggcggcatcggcaccgtccactcggtgccgcggctgatgcccgggcagggcctgatcgtc
ggcgtcggtgccatggagtaccccgccgagttccagggcacctcccaggacaccctgaac
aagctgggcatctccaaggtcatgacgctgaccagcacctatgaccaccgggtgatccag
ggcgccgcctccggcgagttcctgcggatcatgaaccaactgctgctcggcgagaacgac
ttcttcgacgagatcttcaaggcgctgcggatcccctacgagccggtccgctggctcaag
gacatcgacgtcagccacgacgacgacgtcaccaaggcggcgcgggtcttcgacctgatc
cactcctaccgggtccgcggccatgtcatggccgacaccgacccgctggagtaccgccag
cgcaagcaccccgacctggacatcatcgagcacgggctcaccctgtgggacctggagcgc
gagttcgcggtcggcggcttcgcgggcaagaccatgatgaagctgcgcgacatcctgggc
gtgctgcgcgactcgtactgccgcaccaccggcatcgagttcatgcacatccaggacccc
aagcagcgcaagtggatccaggaccgcgtcgagcgcaaccacgacaagccggagcgcgag
gagcagttgcgcatcctgcggcggctcaacgcggccgaggcgttcgagaccttcctccag
accaagtacgtcggccagaagcggttctccctggagggcggcgagtccgtcatcccgctg
ctggacgcggtgctggacgcggccgccgagtcgcggctggacgaggtcgtcgtcggcatg
gcccaccgcggccggctgaacgtgctcgccaacatcgtcggcaagtcgtacgcgcagatc
ttccgcgagttcgagggcaacctcgacccgaagtccatgcacggctccggtgacgtcaag
taccacctgggcgccgagggcaccttcaccggtctggacggcgagcagatcaaggtctcg
ctcgccgcgaacccctcccacctggaggccgtggacccggtcctggagggcgtcgtccgc
gccaagcaggacatcatcggcaaggccggcaccgacttcacggtgctgcccgtcgccctc
cacggcgacgcggccttcgcgggccagggtgtggtcgccgagacgctgaacatgtcgcag
cttcgcggctaccgcaccggcggcaccgtgcacatcgtgatcaacaaccaggtcggcttc
accgccgccccggccgcgtcccgctcctcgatgtacgccacggacgtcgcgcgcatgatc
gaggcgccgatcttccatgtgaacggcgacgacccggaggccgtcgtgcgcgtcgcgcgg
ctcgccttcgagttccgccaggcgttcaacaaggacgtggtcatcgacctgatctgctac
cgccgccgcggccacaacgagaccgacaaccccggtttcacccagccgctgatgtacgac
ctgatcgacaagaagcgctcggtgcgcaagctctacaccgagtcgctgatcgggcgcggc
gacatcacgctggaagaggccgagcaggcgctgcaggacttccagggccagttggagaag
gtcttcaccgaggtccgcgacgcggtctcggccccggctccggccgaggtccccgagccg
caggcggagttcccggtcacggtccagacggccgtctcccaggaggtcgtcaagcggatc
gccgagtcccaggtgaacacccccgaccggatcaccgtccacccgcggctgttcccgcag
ctccagcggcgcgcggcgatgatcgaggacgactcgatcgactggggcatgggcgagacc
ctcgccatcggctcgctgctgatggagggcaccccggtccggctcgccggccaggactcc
cgccgcggcaccttcggccagcgccacgcggtgctggtggaccgcgagaccggcgacgac
tacaccccgctgctgtacctcaccgaggaccaggcgcggtacaacatctacgactcgctg
ctcagcgagtacgcggcgatgggcttcgagtacggctactcgctggcccgtccgaacgcg
ctggtcatgtgggaagcgcagttcggtgacttcgtcaacggcgcgcagaccatcgtggac
gagttcatctcgtcggccgagcagaagtggggccagacctctggtgtcacgctgctgctg
ccgcacggttacgagggccaggggccggaccactcgtcggcccgtatcgagcgcttcctc
cagctctgcgcgcagaacaacatgacggtcgccgcgccgacgctgccgtcgaactacttc
cacctgctgcgctggcaggtccacaacccgcaccacaagccgctggtcgtcttcaccccg
aagtcgatgctgcgtctgaaggccgcggcgtcgaggaccgacgagttcctcaacggctcc
ttccgtccggtgatcggcgacgagacggtcgacccggccgcggtgcgcaaggtggtcttc
tgctccggcaaggtctactacgacgtggccgcggagcgggacaagcgcggtgcgaacgac
acggcgatcatccgcctggagcggctgtacccgctgccgggtacggagctgcaggccgag
atcgccaagtactcgggtgtcgagaagttcgtgtgggcgcaggaggagccggccaaccag
ggtgcctggccgttcgtcgcactcaacctgatcgaccacctggagctgtcggtcggcgcg
gacgtccccgccgccgagcgcctggtccgggtctcgcgtccgcattcgtcctcgcccgcg
gtggggtcgaacaagcggcaccagtcggagcagcaggcgctggtgaacgagatcttcgag
atctga

DBGET integrated database retrieval system