KEGG   Streptomyces violaceusniger: Strvi_5102Help
Entry
Strvi_5102        CDS       T01602                                 

Definition
(GenBank) glycoside hydrolase family 2 sugar-binding protein
  KO
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
svl  Streptomyces violaceusniger
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Strvi_5102
  Lipid metabolism
   00600 Sphingolipid metabolism
    Strvi_5102
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Strvi_5102
Enzymes [BR:svl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Strvi_5102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5660186..5663296
Genome map
AA seq 1036 aa AA seqDB search
MAVTRRSILIAGTAAPMAGALVTANPAQGALASRAMGGRTIPLTDGWRFALVNPGGITDP
TGAYETAHDPAYDDSAWREVAVPHDWSIELSPTTDHGTSGGTGFLPGGLGWYRTTFTLPR
TLEGKRICVEFDGVYMDSSVYCNGRPLGEHPYGYTGFALDLTEVAHTDGATPNVLAVKVR
NRLPSSRWYSGSGIYRHARLVVTDPVHVARWGTYLTTPGLATALRAGYATVRARTLVVNA
SDGPKPVTVVSTVKDPDGHTVVQAHSTVTIGAGDTRTATQELRIDRPRLWSFDTPERYVL
ETELRVGQDTTDRYRTPFGLRHVTLDPDRGFSLNGEYAKLQGVDLHHDLGALGAAVNTDA
VLRQVAIMKSMGVNALRTSHNPPSPELIEVCERLGIVMLVEAFDCWRTGKNTYDYGRFFD
EHCEADITEMVRAARNSPAVVMWSIGNEIPDSTSAPGLGMAQRLIDAVRAADDTRPVVIG
SDKYRGLPAEGSPADLMLAKLDGLGLNYNTAASVDALHARYPRLFLFESESSSETSTRGA
YQEPEHLNTGENHTPGRRETSSYDNNLASWTMSGEYGLKKDRDRRFFAGQFLWSGIDYIG
EPTPYDVFPVKASFFGAVDTAGFPKDMYYLFKSQWTGEPMVHLVPMDWTGHRPGETVEVW
AYSNVASVELFLDGRSLGVREFDAKKTTDGRAYLETTEPTGDDKTVTSGPYPGSYTSPGG
SAGKLHLTWKVPFARGELKAVARRGGRVVATDVLRTAGRPHTVRLTPDRESVDADGRSLC
FVTAEVVDAHGVVVPDAGHPIAFKVTGGSLAGVDNGRQESAERYQASTRTAFHGKALAIV
RSGTEAGPLTITARSAGLRTATTTVRATGGTSQPVTRPVPFAPDPGPGAPDQPRADASYS
GAPTTLPAAMLDGDPATGWSNAFHKPATALLPAFDGARKADWVSVTWSGRRRLRRVEVSF
TVDATHTLPASIEVSAWNGHAYVPVRGASVDWATASGTPTVITFDPVRTSRLRLDLTSRH
PGAADGAQRIVAFEAR
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcacgcgcagatcgatattgatcgcaggcaccgccgccccgatggccggggca
cttgtcacggccaatcccgcgcagggcgccctcgcgtcccgcgccatgggaggacggacg
atcccgctcacggacggctggcgcttcgccctcgtcaaccccggtgggatcaccgacccg
accggcgcgtacgagaccgcccacgacccggcgtacgacgactcggcctggcgcgaggtc
gccgtcccgcacgactggagcatcgagctctcccccaccaccgaccacggcaccagcggc
ggcaccggtttcctgcccggcggcctcggctggtaccgcaccaccttcaccctgccgcgc
accctcgagggcaagcggatctgcgtcgaattcgacggcgtctacatggactcgtccgtg
tactgcaacggacggcccctcggtgaacacccctacggatacaccggcttcgccctcgac
ctcaccgaggtggcccacaccgacggcgccactcccaacgtcctcgccgtcaaggtgcgc
aaccgccttcccagcagccgctggtactcgggcagcggcatctaccgccatgcccggctc
gtcgtcaccgacccggtccatgtggcccggtggggcacgtacctcaccacccccggcctg
gccaccgccctgcgcgccggatatgccacggtgcgggcgcggaccctcgtcgtcaatgcg
tcggacggcccgaagccggtgaccgtggtctccaccgtcaaggaccccgacgggcacacg
gtggtccaggcgcactccaccgtcacgatcggggcgggtgacacccgtaccgccacccag
gagctcagaatcgaccggccgcggttgtggtcgttcgacaccccggagcgctatgtcctg
gagaccgaactgcgggtcggccaggacaccaccgaccggtaccgcacccccttcgggctc
cgccatgtcaccctcgaccccgaccgcggattctcgctgaacggcgagtacgccaagctc
cagggcgtcgatctccaccatgacctgggcgcgctcggcgccgccgtcaacaccgacgcc
gtgctgcgccaggtggccatcatgaagagcatgggcgtcaatgccctgcgcacctcgcac
aatccgccctcaccggagctgatcgaggtctgcgagcggctcggcatcgtgatgctcgtg
gaggcgttcgactgctggcgcaccggcaagaacacctatgactacgggcgcttcttcgac
gagcactgcgaggcggacatcaccgagatggtgcgcgccgcccgcaactcccccgccgtc
gtcatgtggtccatcggcaacgagatccccgactccaccagcgccccggggctgggcatg
gcccagcggctcatcgacgccgtccgcgcggccgatgacaccagacccgtcgtgatcggc
tcggacaagtaccgcggtctgcccgccgagggctcccccgccgacctgatgctcgccaag
ctggacgggctcggcctcaactacaacacggccgcctcggtggacgccctgcacgcccgc
tacccgcggctgttcctcttcgagtccgagtcctcctcggagacctccacccgcggggcc
tatcaggagcccgagcacctcaacacgggcgagaaccacacccccggcaggcgcgagacc
tccagttacgacaacaacctcgcctcctggacgatgagcggcgagtacgggctgaagaag
gaccgggaccggaggttcttcgccgggcagttcctgtggtcgggcatcgactacatcggc
gagcccacgccgtacgacgtgttcccggtgaaggcgtcgttcttcggcgcggtggacacc
gcgggcttccccaaggacatgtactacctgttcaagagccagtggaccggcgaaccgatg
gtccatctggttcccatggactggaccggccaccggccgggcgagaccgtggaggtgtgg
gcctactccaacgtcgcctcggtggagctgttcctggacggccggtcgctgggggtccgc
gagttcgacgccaagaagaccacggacggccgcgcctacctggagaccaccgagcccacc
ggcgacgacaaaaccgtcacctcaggcccctaccccggcagctacaccagtccgggcggc
agcgccggaaagctccacctcacctggaaggtgccgttcgcacggggtgagctgaaggcc
gtggcccggcgcggcggccgggtcgtggccaccgatgtgctgcgcacggcgggacgcccg
cacaccgtacggctgacccccgaccgcgagagcgtcgacgccgacggccgctcgctgtgc
ttcgtgaccgccgaagtggtcgatgcccacggtgtggtggtgcccgacgccggccatccg
atcgccttcaaggtcaccggaggctccctggccggggtcgacaacggccgccaggagagc
gccgagcgctaccaggcgagcacccgcaccgccttccacggcaaggccctggccatcgtc
cgctccggcaccgaggccgggccgctgaccatcacggcccgctcggcggggctgcgcacc
gcgaccaccaccgtccgcgccaccggcgggacatcgcagccggtcacccgcccggtgccc
ttcgcgcccgaccccggccccggcgccccggatcagccacgcgccgacgcgagctattcg
ggcgcgccgacgaccctgcccgcggccatgctggacggcgatccggccaccggctggtcc
aacgccttccacaagcccgccacggcgctgcttcccgccttcgacggcgcccggaaggcc
gactgggtctcggtgacctggagcgggaggcggcggctgcgccgcgtggaggtgtccttc
accgtcgacgccacgcacaccctgcccgcctcgatcgaggtctccgcatggaacggccat
gcctacgtcccggtgcgcggggcgtccgtcgactgggccaccgcctccggcaccccgacg
gtcatcaccttcgacccggtccgcacctcccggctccggctggacctcaccagccgtcat
ccgggcgcggccgacggcgcccagcgcatcgtcgccttcgaggcccggtga

DBGET integrated database retrieval system