KEGG   Streptomyces violaceusniger: Strvi_5345Help
Entry
Strvi_5345        CDS       T01602                                 

Definition
(GenBank) DNA polymerase LigD, ligase domain protein
Organism
svl  Streptomyces violaceusniger
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AEM84875
UniProt: G2NUQ9
LinkDB All DBs
Position
complement(5981623..5982636)
Genome map
AA seq 337 aa AA seqDB search
MSDPLWALTPAERRLLRPVTHGHGLEGREPMLATLTHERFSDERWLYERKLDGERCVAVR
EGGRVDLFSRNGLSAASAYPELIDALTERATVDWVLDGEVVAFERGRTSFARLQPRMHIS
SPEQARRTGVTVYYYLFDVQAIGDHDVTALPLRRRKTLLRSLLTWSDPLRLTAYRYRDGE
TYYRHACAHGWEGLIAKRVDSSYQHGRSRDWLKFKCERRQELVIGGWTDPRRTRPGLGAL
LLGYYSDGDLVYAGKVGTGFDTRTLEALARRLTELRTPTCPFTRGAPPTGPGVNWARPEL
VAEIAFTEWTAEGRLRHPRFLGLRRDKPAREVVREEP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgatccactgtgggccctgacccccgctgagcgccgactgctcaggcccgtcacc
cacggccatgggctcgaaggccgcgagccgatgctcgcgaccctcacccacgaacgcttc
tccgacgagcgctggctgtacgaacgcaagctggacggcgagcgctgcgtcgccgtccgc
gaaggcggccgcgtcgacctgttcagccgcaacggcctctccgccgcctccgcctatccc
gaactcatcgacgccctcacggagcgagccacggtcgactgggtcctcgacggcgaggtg
gtggccttcgaacgcggacgcaccagcttcgcccgcctccagccgcggatgcacatcagc
tcccccgagcaggcccggcgcaccggcgtcaccgtgtactactacctcttcgacgtccag
gccatcggcgaccacgacgtcaccgcgctgccactgcgccgccgcaagaccctgctgcgc
tccctgctcacctggagcgatccgctgcgtctgaccgcgtaccgctaccgcgacggcgag
acctactaccgccatgcctgcgcacacggatgggaggggctgatcgccaagcgcgtcgat
tcctcctaccagcacggccgctcccgcgactggctcaagttcaagtgtgagcggcggcag
gagctggtcatcggcggatggaccgatccccggcgcacccgccccgggctcggcgccctg
ctcctcggctactacagcgacggcgacctcgtctacgcgggcaaggtcggcaccggcttc
gacacccgcaccctggaagccctcgcccgacggctgaccgagctgcgcacccccacctgc
ccgttcacccgtggcgccccgcccaccgggcccggggtcaactgggcgcgccccgaactc
gtcgccgagatcgccttcaccgagtggacagccgaaggccgtctgcgccacccccgtttc
ctggggctgcgccgtgacaaaccggcccgcgaggtcgttcgcgaggagccgtga

DBGET integrated database retrieval system