KEGG   Shewanella violacea: SVI_1271Help
Entry
SVI_1271          CDS       T01206                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
svo  Shewanella violacea
Pathway
svo00240  Pyrimidine metabolism
svo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SVI_1271 (tdk)
Enzymes [BR:svo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SVI_1271 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 UvrD_C Glyco_transf_7N AAA_30
Motif
Other DBs
NCBI-ProteinID: BAJ01242
UniProt: D4ZHU3
LinkDB All DBs
Position
1480209..1480787
Genome map
AA seq 192 aa AA seqDB search
MAQLYFYYSAMNAGKSTSLLQSSYNYRERGMNTLVMTASIDDRYGVGKVSSRIGIETDAQ
VFGSNNDIAKMIAMAHEEQKLHCILIDESQFLSKQQVKQLTYVVDILDIPVLCYGLKTDF
QGELFTGSQYLLAWSDKLVELKTICHCGRKANMVLRLDDEGKPMREGEQVAIGGNESYES
VCRKHFREFLWD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
ttggcacagctctatttttattattcggcgatgaatgccggtaagtctacttctctcttg
cagtcttcatataattatcgcgagcgaggcatgaacaccttagtgatgacggcttcaatc
gatgacagatacggtgtgggtaaagtgtcttcacgaattggtatcgaaaccgatgcgcag
gtatttggtagcaataatgatattgccaagatgatagctatggctcatgaagaacagaaa
ctgcattgtattcttatcgatgaatctcagtttttgagtaaacagcaagttaagcagctg
acctatgtcgtcgacatattggatattcctgtactctgttatggtctgaaaactgatttc
cagggagagctatttaccggtagccaatatctgctggcctggtcagataaactggtcgag
ctcaaaaccatttgtcattgcggccgtaaagcgaacatggtgctgagattagacgatgag
ggcaaacccatgcgtgagggggaacaggtcgccataggtggcaatgagagctatgaatca
gtttgccgcaagcacttcagagagtttttgtgggattaa

DBGET integrated database retrieval system