KEGG   Shewanella violacea: SVI_3021Help
Entry
SVI_3021          CDS       T01206                                 

Definition
(GenBank) glutamate decarboxylase, putative
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
svo  Shewanella violacea
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SVI_3021
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SVI_3021
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SVI_3021
   00430 Taurine and hypotaurine metabolism
    SVI_3021
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SVI_3021
Enzymes [BR:svo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SVI_3021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3428679..3430331
Genome map
AA seq 550 aa AA seqDB search
MSMTPRRATASEEALLRIFTVPEAPDSTLSVIEKNISQNLMGFLQESVVAVEKPLSEIEL
DFQQHQIPSAPQFVSDYADEMMKTLVAHSVHTSSPSFIGHMTSALPYFVLPLSKMMVGLN
QNLVKIETSKAFTPLERQVLGMMHHLIYSEDDKFYKNWMHSANYSLGAFCSGGTIANITA
LWTARNQLLKADGDFKGVSAQGLMKGLRHYGYDDLAILVSERGHYSLAKTADLLGIGRDN
IIQVPTSSDNKVDVDKMRAMAKQLDLDNIKVMAIVGVAGTTETGNIDPLDELATLAVELN
CHFHVDAAWGGASLLSNKYRHLLKGIERADSVTIDAHKQMYVPMGAGMVIFKDPAFANAI
KHHAEYILRKGSKDLGSQTLEGSRPGMAMLVHACLQIIGRDGYEILINNSLEKARYFAEL
IHGQDDFQLVSEPELCLLTYRYVPKSVQEAMQETRESGNTEKLIEFNSLLDGLTKFVQKR
QREQGTSFVSRTRINPESRASLNIQSVVFRVVLANPLTTREILQQVLAEQIEIAQQDNEF
LPQLLALASN
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgacacccagacgagccacagcttcggaagaggcattattgcgcatcttcaca
gtaccagaagcccctgattctacattaagcgtcatcgagaaaaacatatcgcaaaactta
atgggcttcttgcaagagagtgtggttgccgtcgaaaagcctttatctgagatagagcta
gatttccaacagcatcaaatcccctctgcgcctcagtttgtctcagactatgccgatgag
atgatgaagaccttagtggcgcactcggtgcatacgtcatcccctagctttattggtcat
atgacctcggctctgccttacttcgtcttacctctgtctaagatgatggtcgggcttaac
cagaatctggtaaaaattgagacctctaaagccttcacgccactggaacgtcaagtctta
ggcatgatgcatcacctgatctacagtgaagatgataagttttacaaaaactggatgcac
agcgccaactactccctcggagcattttgctcaggcggcactatcgctaacatcacagcc
ctatggactgcacgtaatcagctgctcaaggctgacggagatttcaagggcgtttcggct
caaggcctgatgaagggactgcgtcactatggctatgatgatttagccatcttagtctcc
gagcgtggtcactactcattggcgaaaacggcagacctgcttggcataggccgagataac
atcattcaggtgcccacatccagtgacaacaaggtcgatgttgataagatgcgcgccatg
gcgaaacagcttgatctggacaatatcaaggtaatggccatagtcggtgttgctggcacc
acagaaacaggcaatatcgaccccttagacgaacttgccacactggctgtagagcttaat
tgccatttccacgtcgatgcggcttggggcggcgcctcattattatccaacaagtaccgc
cacctgcttaaaggcatagaacgcgccgactctgtgacaatcgatgctcacaaacagatg
tatgtgcccatgggtgcgggtatggtgattttcaaagacccagcctttgccaacgccatc
aaacaccacgccgaatacatattacgcaagggttctaaagacctgggaagtcaaactctg
gagggatcgcgtcctgggatggccatgctggtccatgcttgcctgcagatcattggccga
gatggttacgagattttaatcaataacagtctggagaaggcacgttatttcgccgaacta
atccatggccaagatgacttccagctggtatctgagcccgaactctgtctgctcacctat
cgctatgtgcctaaatcggtacaagaggcgatgcaagagacaagagagagtggtaacact
gagaagttaattgaatttaatagcttactcgacggcctgactaagtttgtccagaaacgt
caacgagaacaaggcacctcatttgtttcccgtactcgtattaaccctgagagccgcgca
agtctgaatatccaatctgtggtgtttcgagtagtactggctaatcccctcaccacccgt
gagatattgcagcaggtcttagccgagcagatagagatagcccaacaagataacgagttc
ttaccgcaactcttggctctcgcctctaactaa

DBGET integrated database retrieval system