KEGG   Shewanella woodyi: Swoo_3435Help
Entry
Swoo_3435         CDS       T00676                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
swd  Shewanella woodyi
Brite
Enzymes [BR:swd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Swoo_3435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ACA87703
UniProt: B1KQU7
LinkDB All DBs
Position
4202796..4203464
Genome map
AA seq 222 aa AA seqDB search
MIDLYTAATPNGHKISIALEEMGLEYRVHHLDLMQADQKKPEYLAINPNGRIPAIIDRDN
DDFAVFESGAILLYLAEKTGKLLPTNPKKRSQVIQWLMFQMGGVGPMMGQANVFHRYFPE
KIPAAIERYQNESRRLFEVMNLQLSDNRYLAGDEYSIADISTWPWVRIYEWSGVDISGLE
HLQRWMDELAERKACQIGVITPPPSDLSDKERAEQISKMVSR
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgatagacctctatacagcagcaacccctaatggtcataagatctctatcgctttagag
gagatgggactcgaatacagagttcatcacctagatctgatgcaagccgatcagaaaaag
cctgagtatttagcgataaaccctaatgggcggatcccagcaattatcgaccgagacaat
gatgattttgccgtctttgagtcaggtgctattttgctctacctggcagagaaaacaggt
aaattgctccctactaatcctaaaaagcgctcccaagtgatccaatggctgatgttccag
atgggtggtgtggggcctatgatggggcaagcaaatgtgtttcaccgctacttcccagag
aagatccccgcagcaatcgagcgatatcaaaatgagagtcgtcgcctatttgaggtgatg
aacctgcaattatcagataaccgctatttggctggagatgaatactccatcgccgatatc
tccacttggccatgggtacgaatttatgagtggagtggtgtcgacatttcagggctagaa
catcttcagcgctggatggatgaattagccgaacgaaaggcctgtcaaataggcgttatc
actccaccaccttcggatctcagtgataaggagcgagccgagcagataagtaaaatggtt
tcgaggtaa

DBGET integrated database retrieval system