KEGG   Sphingomonas wittichii: Swit_4211Help
Entry
Swit_4211         CDS       T00538                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
swi  Sphingomonas wittichii
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Swit_4211
   00650 Butanoate metabolism
    Swit_4211
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Swit_4211
   00280 Valine, leucine and isoleucine degradation
    Swit_4211
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Swit_4211
Enzymes [BR:swi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Swit_4211
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Swit_4211
Amino acid related enzymes [BR:swi01007]
 Aminotransferase (transaminase)
  Class III
   Swit_4211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
4639396..4640673
Genome map
AA seq 425 aa AA seqDB search
MTSNADLLARRRQAVARGVATAFPIFAARADNAEIWDVDGQHYVDFAGGIAVLNTGHRHP
KVIAAVQEQLALYTHMAFQVAAYEPYVALAERLNALAPFTGEAKTILFTTGAEATENAVK
LARAATGRSAVIAFGGGFHGRTLLAMAMTGKVAPYKQQFGPMPGEIFHVPFPVAAHGGSV
EETLRAIEMVFRVAVEPGRVAALIIEPILGEGGFYEAPVELLRALRALCDRHGIILIADE
VQTGFGRTGRMFAIEHSGVEPDLVTVAKSLAGGFPLSGVIGRSAIMEASEPGGMGGTYGG
NPVACAAALAVLDVIAEEQLLDRAVAIGARIKERLRLLARRNDLVPITEIRGPGAMIGFD
IVTSRTGYEPDPETTRRVVEAAREAGLILLSCGIHGNVIRILVPLTVPDDILDAGLAKLE
QALAA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaacgcggatcttctggcacgccgccgtcaggcggtggcgcgcggggtcgcc
acggcctttccgatcttcgcggcccgcgccgacaatgccgagatctgggacgtcgacggc
cagcattatgtggattttgccggcggcatcgccgtgctcaacaccgggcaccgccacccc
aaggtcatcgccgccgtgcaggagcagttggcgctctacacccatatggcgttccaggtc
gcggcctatgaaccctatgtcgcgctcgccgagcggttgaacgcgctcgcgcccttcacc
ggcgaggcgaagacgatcctgttcaccaccggagccgaggcgaccgagaatgcggtcaag
ctggcgcgggcggcgaccggccggtcggccgtgatcgcctttggcggcggcttccatggc
cgcaccctgctggcgatggcgatgaccggcaaggtcgccccgtacaagcagcagttcggg
ccgatgcccggcgagatcttccatgtcccctttccggtcgcggcgcatggcggcagcgtc
gaggagacgctgcgcgcgatcgagatggtcttcagggtcgccgtcgagccgggccgggtc
gccgccctgatcatcgagccgatcctgggggagggcggcttctacgaggctcccgtcgaa
ctgctcagggcgttgcgtgccctctgcgaccggcacggcatcatcctgatcgcggacgag
gtccagaccggcttcggacggaccgggcggatgttcgccatcgagcattcgggggtcgag
cccgacctcgtcaccgtcgccaagtcgctggccgggggtttcccgctctcgggcgtgatc
ggtcgatccgcgatcatggaggcgagcgagccgggtggaatgggcggcacctatggcggc
aacccggtcgcctgcgcggcggcgctcgccgtgctcgacgtgatcgcggaggagcaactg
ctcgaccgcgcggtcgcgatcggggcgcggatcaaggagcggctgcggctgttggcgcgg
cgcaacgacctcgtgccgatcaccgaaatccgcggacccggcgcgatgatcggcttcgac
atcgtcacttcgcggaccggctatgagcccgaccccgagacgacgcgccgggtcgtcgag
gcggcgcgcgaggcgggattgatcctgctgtcctgcggcatccacggcaacgtcatccgg
atattggtgccgctgaccgttccggacgatatcctcgatgccgggctcgccaagctcgaa
caggcgctggcggcatga

DBGET integrated database retrieval system