KEGG   Shewanella piezotolerans: swp_2383Help
Entry
swp_2383          CDS       T00791                                 

Definition
(GenBank) Peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
swp  Shewanella piezotolerans
Brite
Enzymes [BR:swp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     swp_2383
Peptidases [BR:swp01002]
 Metallo Peptidases
  Family M2
   swp_2383
Exosome [BR:swp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   swp_2383
CD molecules [BR:swp04090]
 Proteins
  swp_2383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2492440..2494275)
Genome map
AA seq 611 aa AA seqDB search
MNMTFTKVSKLSVLIAISLGVTACNKTEAVDTPTVDKIAEAKQFITDAESTMADLSIEIN
RSEWIYSNFITEDTAALSASVAEKYTGTSVQLATESAQYAHLALDPADKRKLNILRSSIV
LPAPLDPVKNAELANISAELNGLYGKGKYCFQDGRCLTQPELSAIMGESNNPDELLEVWK
GWREISKPMRPLFEREVELANEGAQDLGYANLSELWRSQYDMKPDEFSDELDRLWGQVKP
LYDSLHCYVRGELNEQYGDTVAPATGAIPAHLLGNMWAQSWGNVYDQVAPQDADPGYDVT
ELLAKHNYDEIKMVKQAESFFTSLGFEELPDTFWDRSLFVQPKDRDVVCHASAWDLDNED
DIRIKMCIQKTAEDFTVIHHELGHNFYQRAYKEQPFIFKNSANDGFHEAIGDTVALSITP
NYLKQIGLLDEVPDASKDIGLLLKQALDKVAFLPFGLMIDQWRWKVFSGEITPAQYNQAW
WDLREKYQGVKAPVARNESDFDPGAKYHVPGNVPYTRYFLAHILQFQFHKSLCEIAGDNG
PVHRCSIYGNKEAGAKLNTMLEMGQSKPWPEALAAVTGTKEMDAKAVLDYFAPLQIWLDE
QNKTANRQCGW
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgacctttaccaaggtttctaagctatcagtattgatagccatttcgctcggc
gtaacagcctgtaataaaacagaagcggtagatacaccaactgttgataaaatcgctgag
gcgaaacagttcattacagatgcagaatctacgatggcagatttatccattgagataaat
cgttcagagtggatctacagcaattttattaccgaagacactgcagcgttatcagccagt
gtggctgagaaatacactggtacctctgtacagctagcgacagagtcagctcaatatgca
cacttagcattagaccccgcagacaaaagaaagttaaacatattacgcagttccatagtg
cttcctgcgcctttagatcccgttaaaaacgctgaactagccaatattagtgcagaatta
aacggactctacggcaaaggaaaatattgcttccaagatggccgttgtttaacccaacca
gaactatcagcaataatgggtgaatctaataacccagatgagctacttgaggtatggaaa
ggctggcgtgaaatatctaagccaatgcgccccttatttgaaagggaagttgaactggca
aacgagggggcgcaagatcttggttatgctaacctatctgagttgtggcgcagccagtat
gatatgaaaccagacgagttctcggatgaactcgaccgtctatggggacaagtcaaacca
ctctatgactcgctgcattgctacgtgcgtggcgaactaaatgagcagtacggtgatacc
gttgcgccagcaactggcgcaattccagctcacctacttggcaatatgtgggctcaaagc
tggggcaatgtttatgatcaagttgcaccgcaagatgcagatccaggctatgatgtcacc
gaactgctagctaagcataactacgatgaaatcaagatggtcaaacaggccgagagcttt
tttacttcacttggttttgaagagttaccggatactttctgggatagatcattattcgtt
caaccaaaagatcgggatgtcgtctgtcacgcctctgcatgggacttggataacgaagat
gatatccgcattaagatgtgtatccaaaaaacagcagaagattttaccgtgattcaccac
gaacttggtcacaacttctatcaacgtgcctataaagagcagccatttatctttaaaaat
agcgctaatgacggcttccatgaggccattggcgacaccgttgccctgtctatcacacca
aactatttgaaacagattggtttgctagacgaagtgcctgatgcatcaaaagatattggc
ttattgctaaagcaagctttagacaaggtcgcctttctaccttttggtttaatgatagat
caatggcgttggaaggtatttagcggcgaaatcaccccagcgcaatacaatcaggcatgg
tgggatctgcgtgaaaaataccaaggtgtaaaagcgccagttgcacgtaatgagtcagac
tttgatccaggtgctaaataccatgttcctggtaatgtaccttacacacgctatttctta
gcccatatactgcaattccaattccacaagtcattatgtgaaatcgcgggcgataacgga
cctgttcatcgttgtagtatttatggtaacaaggaagcaggtgccaagttaaacaccatg
ttagagatgggccaaagtaaaccttggcctgaagcactagctgctgtaactggcactaaa
gagatggatgcaaaagctgtactggattacttcgcaccattacaaatttggctagatgag
caaaataaaacggccaatcgccaatgtggttggtaa

DBGET integrated database retrieval system