KEGG   Staphylococcus xylosus SMQ-121: SXYLSMQ121_0799Help
Entry
SXYLSMQ121_0799   CDS       T03311                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
sxl  Staphylococcus xylosus SMQ-121
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sxl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SXYLSMQ121_0799
Enzymes [BR:sxl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SXYLSMQ121_0799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
887449..888048
Genome map
AA seq 199 aa AA seqDB search
MYETYHSGWIECITGSMFSGKSEELIRRLRRGLYAKQKVVVFKPAIDDRYHKDKIVSHNG
NAIEAINISTAAEIFKHDLSDVDVIGIDEVQFFENGIVHIAEQLAEKGHRVITAGLDMDF
RGRPFEPIPELLAVSEDVTKLQAVCAVCGASSSRTQRLIDGNPAKIDDPVILVGANESYE
PRCRAHHIVAPSNDEKEEM
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaacttatcattccgggtggattgaatgtattactggaagtatgtttagtggc
aaatctgaagagttaatacgtcggttaagacgtggcctttacgctaaacaaaaagtagtt
gtgtttaaaccagctatagatgaccgttatcataaagacaaaattgtttctcataatggt
aatgcaatagaagcaattaatatatcaacagcagcagagatttttaaacacgatttatca
gatgtagatgtaatcggtatagatgaagtacaattttttgaaaatggaattgttcatatc
gctgagcaattagctgaaaaaggacatagagtcataacagctggtttagatatggatttt
agaggtagaccttttgaacctataccagagctgttagcagtgagtgaagatgtaacgaaa
ttacaagctgtttgtgcggtttgtggggcgtcatcaagtcgtactcaacgattaatagat
ggtaacccagccaaaatagatgacccagttatattagttggtgcaaatgaaagttatgaa
ccgagatgtagggcacaccacattgtcgcaccgagtaatgatgagaaggaggaaatgtag

DBGET integrated database retrieval system