KEGG   Synechococcus elongatus PCC6301: syc1846_dHelp
Entry
syc1846_d         CDS       T00163                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    syc1846_d (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    syc1846_d (ppc)
   00680 Methane metabolism
    syc1846_d (ppc)
Enzymes [BR:syc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     syc1846_d (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
1994940..1998101
Genome map
AA seq 1053 aa AA seqDB search
MLAVSLRDHGFPSATVQIRPAFCVQSDVVGSGNPPRMNYCQNARTAMSAALQSSDDAFRT
VSSPLATDLDLSSPLEFFLRHRLTVVEELWEVVLRQECGQELVDILTQLRDLTSPEGQAP
EVGGEALVQVIETLELSDAIRAARAFALYFQLINIVEQHYEQTQYQLAYERSRLEPLPGP
DESPEGLHTIEIPQHQLDPFAAVIPLNQDPATFQTLFPRLRQLNVPPQMIQELTDRLDIR
LVFTAHPTEIVRHTIRDKQRRIAYLLRQLDELETGKNRGFRELEAQNIRQQLTEEIRLWW
RTDELHQFKPTVLDEVDYALHYFQEVLFEAIPLLYQRFRLALQGTFPDLQPPRYNFCQFG
SWVGSDRDGNPSVTSAVTWQTACYQRSLVLDRYITAVEHLRNVLSLSMHWSEVLPELLSS
LEQESMLFPETYEQLAVRYRQEPYRLKLSYILERLHNTRDRNTRLQQQQEKDPTTPLPEY
RDGTLYQAGTAFLEDLKLIQHNLKQTGLSCYELEKLICQVEIFGFNLVHLDIRQESSRHS
DAINEICEYLQILPQPYNELSEAERTAWLVQELKTRRPLVPARMPFSESTREIIETLRMV
KQLQEEFGEAACQTYIISMSRELSDLLEVLLLAKEVGLYDPVTGKSSLQVIPLFETVEDL
QNAPRVMTALFELPFYTQLNPTQSEPLQEVMLGYSDSNKDSGFLSSNWEIHKAQKALGTV
ARDHRVKLRIFHGRGGSVGRGGGPAYEAILAQPGRTTDGRIKITEQGEVLASKYALPELA
LYNLETITTAVIQSSLLGSGFDDIEPWNQIMEELAARSRRHYRALVYEQPDLVDFFNQVT
PIEEISKLQISSRPARRKTGKRDLGSLRAIPWVFSWTQSRFLLPSWYGVGTALQEFLQER
PEQNLNLLRYFYEKWPFFRMVISKVEMTLAKVDLQIAHHYVHELANPEDQERFERVFSQI
AAEFQLTCHLVLTITNHGRLLDGDPELQRSVQLRNGTIVPLGFLQVALLKRLRQYRQQTE
TTGLMRSRYSKGELLRGALLTINGIAAGMRNTG
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctgtatctctcagggatcacggcttcccgtcagcaactgtccagatccgccct
gcgttctgtgtccagtcagacgtggtgggatcagggaatccacctagaatgaattactgc
cagaacgctcgaactgccatgagtgctgctctccagtcatccgacgatgctttccgaacc
gtttcgagtcccctcgccacggatttggatctgtcgtctccgctggagtttttccttcgc
catcgcttgacggtggttgaagaactctgggaagtggttttgcgccaagagtgcggccaa
gagctggtcgatattctgactcagctgcgtgacttgacctcgccggaaggccaagcccca
gaagtgggcggcgaagccttggttcaggtgattgaaaccctagagttgagcgatgcgatt
cgggctgcccgtgcctttgcgctctactttcagctgatcaatattgttgagcagcactac
gagcaaactcaatatcaactcgcctacgagcgatcgcggttggaacccttgccaggacca
gatgaaagtccggagggattgcacaccattgaaattcctcagcatcagctcgatcccttt
gctgcggtgattccgctcaaccaagatccggcaaccttccaaacgctgttcccgcgcctg
cgccagctcaatgtgccgccgcaaatgatccaagagctgaccgatcgcctcgatattcgg
ctggttttcaccgctcacccgacggaaattgtccgccacacgattcgcgacaaacaacgc
cgaattgcctacctgctgcggcaactggatgagctcgaaacaggcaaaaaccgaggcttt
cgagagcttgaagcgcagaatattcgtcagcagctgaccgaggagattcggctctggtgg
cggacggatgagctccaccagttcaagccaacggtgttggatgaggtggactacgcgctc
cactacttccaagaagtcctctttgaggccattcctctgctctatcagcgctttcggctc
gcgctgcaggggactttccccgacctacaaccgccccgctacaacttctgccagttcggc
tcttgggtcggctccgatcgcgatggcaatccttcagtgacctctgccgtcacttggcaa
accgcttgctatcagcgcagtctcgtcctcgatcgctacatcacagcggttgaacatctc
cgcaatgtgctcagcctctcgatgcactggagcgaggtgctgccggagttgctcagctcg
ttggaacaggagagcatgctcttcccggagacctatgagcagctagcggtccgctatcgc
caagagccctatcgcctcaagctctcctatattctggagcgcctgcacaacacccgcgat
cgcaatacccgcctccaacagcagcaagaaaaagatcccaccacgcccctgcccgaatat
cgggatggcaccctctaccaggctggtacggcctttctcgaagatctcaagctgattcag
cacaaccttaagcagacgggactgagctgttacgagctagagaagttgatctgccaggtc
gagatctttggtttcaacctggtccatctcgacattcgccaagaaagctcgcgccattcc
gacgcgatcaacgaaatctgtgaatacctccaaattcttccccagccctacaacgagctg
agcgaagcagaacgaactgcctggctggttcaagagctgaaaacccgtcggccgctggta
ccagcgcgcatgccgttctcagaatcgacccgcgagatcattgaaaccctgcggatggtc
aagcagctacaggaagaatttggggaggcggcttgccaaacctacatcatcagcatgagc
cgcgagctgagcgacctgctggaagtgctgctgctggccaaggaggttggtctctacgac
ccagtcaccggcaagagttcgcttcaggtgattccgctgtttgaaactgtggaggactta
caaaatgccccgcgggtgatgacggcgctgtttgagctgcccttctacacccagctcaac
cccacccagtctgaaccgctgcaggaagtgatgctggggtattccgacagtaacaaggac
tcgggcttcctcagcagtaactgggagatccacaaggcccagaaagccctagggacggta
gcccgcgaccaccgcgtcaagctgcggatcttccacggccgcgggggctccgtcggtcga
ggtggtggccctgcctacgaggcgatcttggcccagccgggtcgcaccacagatggccga
atcaagattacggaacagggcgaggtcttggcttcgaaatacgccctgcccgaactggcg
ctctataaccttgagacgatcacgacggcggtgattcagtccagcctgctgggtagcggc
tttgatgacattgagccgtggaaccaaattatggaagagttggcggcgcgatcgcggcga
cattaccgcgctttggtgtacgagcagcccgacctggttgacttcttcaatcaggtaacg
ccgattgaggagatcagcaaactgcaaatcagctcgcgaccggctcgacgcaaaaccggc
aagcgcgatctgggcagtctacgtgccatcccctgggtctttagctggacgcagagtcgt
tttctgctgccctcttggtatggcgtcggcacagcacttcaggagtttttgcaggagcgc
ccggagcagaacctcaacctgctgcgctacttctacgagaagtggccgttcttccgcatg
gtgatctcgaaggtcgagatgaccctagcgaaggtcgatttgcagattgctcatcactac
gtgcatgagctggccaatcctgaggatcaagagcggtttgaacgagtgttcagccaaatc
gctgcagagtttcagctgacttgtcatctcgtgttgacgattaccaaccacggtcgcttg
ctggatggcgaccccgaactgcagcgatcggtgcagctgcgcaacggtacgatcgtgccc
ctcggcttcttgcaagtcgccctgcttaaacgcctgcggcagtatcgccagcaaacggaa
acgacgggattgatgcgatcgcgctatagcaaaggggaactgctgcgcggagcattgctg
acgatcaacggcattgcggctggcatgcgcaatacaggttga

DBGET integrated database retrieval system