KEGG   Synechococcus sp. CC9902: Syncc9902_1933Help
Entry
Syncc9902_1933    CDS       T00293                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sye  Synechococcus sp. CC9902
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Syncc9902_1933
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Syncc9902_1933
   00680 Methane metabolism
    Syncc9902_1933
Enzymes [BR:sye01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Syncc9902_1933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
1847488..1850475
Genome map
AA seq 995 aa AA seqDB search
MPESTAHALQGEQPRESGVTAGAGRLLQNRLVLVEDLWQTVLRSECPPEQSARLLRLKQL
SDPVALEGRDGDSTSEAIVELIRAMDLSEAIAAARAFSLYFQLINILEQRIEEDSYLDSL
APRKSAADDGRDAFDPFAPPLASQTDPATFGEVFERLRRMNVPPAQVEALLQELDIRLVF
TAHPTEIVRHTVRHKQRRVANLLQQLQSDSPMALQVKDDLRQQLEEEIRLWWRTDELHQF
KPTVLDEVDSTLHYFQQVLFDAMPQLRRRLTSSLHRHYPDVQVPQASFCTFGSWVGSDRD
GNPSVTTDITWRTACYQRQLMLELYISSVQALRNQLSISMQWSQVAPALLESLEMDRLRF
PEIYERRAARYRLEPYRLKLSYILERLERTLKRNDQLSDAGWKSPKDAIPTDGPPGSEAL
HYTSVDQFRNDLELIRNSLIGTELTCEQLDTLLHQVHIFGFSLASLDIRQESTRHSDAID
ELTRFLELPQPYGEMEESTRVAWLIEELRTRRPLIPTAVRWSDTTAETMAVFRMLHRLQE
EFGQRICHSYVISMSHTASDLLEVLLLAKEAGLVDPAARKASLLVVPLFETVEDLQRAPA
VMDELFNTPLYRDLLPMVGIQGQPLQELMLGYSDSNKDSGFLSSNWEIHQAQLALQELSS
RQGVALRLFHGRGGSVSRGGGPAYQAILAQPSGTLQGRIKITEQGEVLASKYSLPELALY
NLETVTTAVVQNSLVTNQLDATPSWNQLMSRLSARSREHYRALVHDNPDLVAFFQQVTPI
EEISKLQISSRPARRKTGAKDLSSLRAIPWVFGWTQSRFLLPSWFGFGTALAEEVKADPD
QLDLLRRLHQRWPFFRTLISKVEMTLSKVDLDLAHHYMNSLGKPEQREAFEAIFAVIATE
YALTRKLVLEITGQPRLLGADQGLQLSVDLRNRTIVPLGFLQVALLKRLRDQNRQPPMSE
SPGAPEDTRTYSRSELLRGALLTLNGIAAGMRNTG
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagtccaccgcccatgcactccaaggcgaacagcccagggagagcggtgtgact
gctggagccggccgattgctgcagaaccgcttggtgttggtcgaagacctttggcaaacg
gttctccgcagcgagtgtcccccagaacaaagtgctcgcctcctccgactaaaacaactg
agtgatcccgtggcccttgaggggcgagacggtgacagcacaagcgaggcgattgttgaa
ttgatccgtgccatggatctttcagaagccattgccgcggccagagcgttctcgctgtat
ttccaactcatcaacatcctcgaacaacgcatcgaggaagacagttatctcgacagcctg
gccccccggaaatcagcagcagacgacggccgcgacgcctttgacccttttgctcctcct
ttggcgagtcagaccgatcccgccacatttggagaagtttttgaacggctccggcggatg
aatgtgccgccagcacaagtcgaagccctactccaggagttggatatccggttggtcttt
accgctcatcccacagagattgttcggcacaccgtccgtcacaagcaacgacgggtcgcg
aatcttctgcaacaactgcagtccgactcgcctatggcgcttcaagtcaaagacgacttg
cgtcagcaactggaagaggagattcgactctggtggagaaccgatgagctgcatcagttc
aagccaacggttctcgatgaagtggattcaacccttcattacttccaacaagtgttgttc
gatgccatgccccaactacggcgacggctcacatcatcacttcaccggcactatcccgat
gtccaagttccccaggcatcgttctgcacctttggatcttgggttggttccgaccgggat
ggcaatccctccgtcacaacggacatcacctggcggaccgcctgctatcagcgtcagctc
atgctcgagctgtacatcagctcggtccaggcgcttcgtaatcagctgagcatttcaatg
cagtggagccaggttgctcctgcgttgctggagtccttggaaatggatcggctgcgcttc
ccagagatctatgagcggcgcgcggcgcgttaccgactagagccttaccgactaaagctg
agctacatcctcgaacgcctggaacgcacgcttaagcgcaacgatcagctctcagatgcg
gggtggaagagtcctaaagatgccatcccaaccgatggaccgcctggatcggaagcgctc
cactacacctcggtcgatcaattccgaaacgacctggaactgatccgcaacagcttgatc
ggcactgaactcacctgcgagcagctcgataccttgctccatcaagtccatatctttggc
ttctcactcgccagtctcgatattcgtcaggagagcacccgccatagcgatgcgattgac
gaactcacgcgttttctcgaattaccacagccctatggcgagatggaagagtccacgcgt
gtggcctggttgattgaagagctccgtacccggcgtccgttgattccaacggcagttcga
tggtcggacaccaccgcggagacgatggccgtcttccgcatgttgcatcgactccaagag
gagttcggccagcggatctgccactcgtatgtgatttcgatgagccacacggcctccgat
ctattggaggtgttactgctcgcgaaggaagcaggactcgtggatccagccgcccgcaaa
gcgtcgctgctggtggtgccactgttcgaaacggtggaagatctacaacgcgcaccagcc
gtcatggacgagctgttcaatacacctctttatcgcgacctactcccgatggtggggatc
caaggccagcccctacaggagctaatgcttggctactccgacagcaataaagactcaggt
ttcctctcgagcaactgggagattcaccaagctcaacttgccctccaagagctgtccagt
cgacagggcgttgcccttcgactgtttcatggtcgcggcggttccgtgagccgtggcggt
ggcccggcgtatcaagccatccttgcccagcccagtggcacccttcagggccgcatcaaa
atcaccgaacaaggggaggtgctggcttcgaagtacagcctgccggagctcgccctctac
aacctggaaacagtcaccaccgcggtcgttcaaaacagcctggtaaccaatcagctcgat
gcgacaccgagctggaaccaactcatgagtcgtctctctgcacgctcccgtgagcactac
cgcgcgttggtacatgacaaccccgacttggtggcatttttccaacaggtgacaccaatc
gaagagatcagcaaactgcagatttccagtcgacctgctcgacgtaaaaccggagccaaa
gatctttcaagcttgcgggcgattccttgggtgtttggctggacgcaaagccgtttttta
cttcccagttggtttggctttggcacagctttagctgaagaggtgaaagcagaccccgat
caactcgatctgctccggcggcttcaccaacgctggccctttttccgcaccctgatttcc
aaggtggagatgaccctctccaaagtggatctcgacttagcgcatcactacatgaacagc
ctggggaaacccgagcaacgtgaggccttcgaggcgatttttgcggtgattgcaacggaa
tacgcgttaacgcggaaattggttttagagatcacaggacaaccgcgcctactcggggct
gatcaagggcttcagctctcagtcgacctgaggaatcgcacgattgtgcctttgggcttt
ctccaggttgcgctgctcaaacggctgcgggatcaaaaccgtcagccaccaatgagtgaa
agtccaggagcacccgaagacacccgtacctacagccgcagtgagttactccgtggggcc
ctgctcacgctgaatgggattgctgctggcatgcgcaacacaggctga

DBGET integrated database retrieval system