KEGG   Synechococcus sp. CC9311: sync_1967Help
Entry
sync_1967         CDS       T00390                                 

Gene name
cbbL
Definition
(GenBank) ribulose bisphosphate carboxylase, large subunit
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
syg  Synechococcus sp. CC9311
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syg00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    sync_1967 (cbbL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    sync_1967 (cbbL)
Enzymes [BR:syg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     sync_1967 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
complement(1750450..1751862)
Genome map
AA seq 470 aa AA seqDB search
MSKKYDAGVKEYRDTYWTPDYVPLDTDLLACFKCTGQEGVPKEEVAAAVAAESSTGTWST
VWSELLTDLDFYKGRCYRIEDVPGDKESFYAFIAYPLDLFEEGSITNVLTSLVGNVFGFK
ALRHLRLEDIRFPIAFIKCCAGPPNGIAVERDRMNKYGRPLLGCTIKPKLGLSGKNYGRV
VYECLRGGLDFTKDDENINSQPFQRWQNRFEFVAEAIKLAEQETGERKGHYLNVTANTPE
EMYERAEFAKELNQPIIMHDFITGGFTANTGLSKWCRKNGMLLHIHRAMHAVIDRHPKHG
IHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQTTLGYIDQLRESFVPEDRSRGNFFDQDW
GSMPGVFAVASGGIHVWHMPALVAIFGDDSVLQFGGGTHGHPWGSAAGAAANRVALEACV
KARNAGREIEKESRDILMEAGKHSPELAIALETWKEIKFEFDTVDKLDVQ
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaagtacgacgctggggtcaaggagtacagagacacttactggactcccgat
tacgttcccctcgacaccgacctgctggcctgcttcaagtgcaccggccaagaaggtgtt
cccaaagaagaagttgcagctgctgttgccgctgaatcttcaactggtacctggtccact
gtgtggtccgagctcctcaccgacctcgacttctacaaaggccgctgctatcgcatcgaa
gacgtccctggtgacaaggagtcgttctatgccttcatcgcttaccccctcgacctgttc
gaagagggttcaatcactaacgttctgacctcattggtcggcaacgtgtttggtttcaaa
gcactgcgtcatctccgtctggaagacattcgcttcccgattgcatttatcaagtgctgc
gctggaccgccaaacggtattgccgttgagcgtgaccgtatgaataagtacggccgccct
cttctgggttgcaccattaagccaaagcttggcttaagcggtaagaactacggccgtgtt
gtctatgaatgcctccgtggcggtctggacttcaccaaagacgacgagaacatcaattcc
cagccgttccagcgttggcagaaccgcttcgaatttgttgcagaagccatcaagctggcc
gaacaggaaacgggagagcgaaagggtcactacctcaacgtgaccgcgaacactcctgaa
gagatgtatgagcgtgctgagttcgccaaggaactcaatcagccgatcatcatgcacgac
ttcatcaccggtggctttacagctaacactggtttgtcgaagtggtgccgcaagaacggc
atgttgctgcacattcaccgtgcgatgcacgctgtgattgaccgtcatcccaagcacggt
attcacttccgcgtcctcgccaagtgcctgcgtttgtcaggtggtgaccaactccacacc
ggcaccgtggtgggcaagctggaaggtgatcgtcagaccaccctcggctatatcgaccaa
ctccgcgaatccttcgttcctgaagatcgcagccgcggcaacttcttcgatcaggactgg
ggttccatgcctggcgtcttcgccgttgcttccggcggtatccacgtgtggcatatgccc
gcactggttgccatcttcggagatgactccgttctccagttcggtggtggtacccacggt
cacccctggggttccgcagctggtgctgctgccaaccgtgtggccctcgaggcctgcgtc
aaggcacgcaacgccggtcgtgaaatcgagaaggaaagccgcgacatccttatggaagcc
ggtaagcacagccctgagctggcgatcgctctcgagacctggaaggagatcaagttcgaa
ttcgacaccgtcgacaaactcgacgttcagtga

DBGET integrated database retrieval system