KEGG   Synechocystis sp. PCC 6714: D082_16940Help
Entry
D082_16940        CDS       T03386                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
syj  Synechocystis sp. PCC 6714
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:syj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    D082_16940 (ppc)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    D082_16940 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    D082_16940 (ppc)
   00680 Methane metabolism
    D082_16940 (ppc)
Enzymes [BR:syj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     D082_16940 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1679910..1683014)
Genome map
AA seq 1034 aa AA seqDB search
MNLAVPAFGLSTHWSGNGNGSNSEEESVLYQRLKMVEELWERVLQSECGQELVDLLTELR
LQGTHEAIASEISEEVIMGITQRIEHLELNDAIRAARAFALYFQLINIVEQHYEQNEQQR
NRWEASQETNFYEQAGNEDELVPPSRLGASAEPLPVGIDQNELQASVGTFHWLMKELKRL
NVPPQHIQNLLDHLDIRLVITAHPTEIVRHTIRRKQRRVDRILRKLDQLQGSVTSRDWLN
TWDAKTAIAQLTEEIRFWWRTDELHQFKPTVLDEVDYSLHYFDEVLFDAVPELSKRLGQA
IKETFPHLRAPRANFCYFGSWVGGDRDGNPSVTPEVTWQTACYQRGLVLGKYLFSLGELV
AILSPSLHWCKVSQELLDSLERDRIQLPEVYEELSLRYRQEPYRMKLAYVTQRLENTLRR
NNRLANPEERQTMISMPAENHYRTGEELLEELRMIQRNLTETGLTCLELENLITQLEVYG
FNLAQLDFRQESSRHAEAIAEIAEYMGVLTSPYEEMSEEDKLAWLGVELQTRRPLIPQEM
PFSERTRETIETLRTLRHLQMEFGVDICQTYIISMTNDASDVLEVLLLTKEAGLYDPATA
SNSLRIVPLFETVEDLKNAPGIMDSLFSLPFYRATLAGSYDSLKELQSQPPDYYQIPTTK
AQLNPGNLQEIMVGYSDSNKDSGFLSSNWEIHKAQKALQAVAQNHRVILRLFHGRGGSVG
RGGGPAYKAILAQPAGTVDGRIKITEQGEVLASKYSLPELALYNLETLTTAVIQASLLKS
SFDFIEPWNRIMEELACTARQAYRSLIYEEPDFLDFFLTVTPIPEISELQISSRPARRKG
GKADLSSLRAIPWVFSWTQTRFLLPAWYGVGTALKSFVDQDPVKNMKLLRYFYFKWPFFN
MVISKVEMTLSKVDLTIASHYVQELSKPEDRERFDRLFQQIKQEYQLTRDFAMEITAHPH
LLDGDRSLQRSVLLRNRTIVPLGLLQISLLKRLRQVTQEAETSGVRYRRYSKEELLRGAL
LTINGIAAGMRNTG
NT seq 3105 nt NT seq  +upstreamnt  +downstreamnt
atgaacttggcagttcctgcattcggtctttccactcactggtctggtaatggcaatggt
tccaactctgaagaagagtcggtgctttaccagcggttaaagatggtggaagaattgtgg
gaaagggtgctccagagtgagtgtggccaggagttggtggatttactgacggaattacgg
ctccagggtacccatgaggcgatcgccagtgaaatttccgaagaggtaatcatgggcatt
acccagcggattgagcatttggaactcaatgatgccatccgagcggcccgggcctttgcc
ctatatttccagttgatcaacattgttgaacagcattacgaacaaaacgagcaacaaagg
aatcgttgggaagcttcccaggaaactaatttttatgagcaggctggtaacgaagatgaa
ctggtgcccccatcccgtttaggggcctcggcggaacccctgccggtgggcattgaccag
aatgagttgcaagcttctgtgggcacgttccattggttaatgaaagaactcaagcgcctc
aatgtccccccccagcatattcaaaatttattggatcatctcgatattcgccttgtaatc
acagcccatcccacggaaattgtccgccataccattcgacgcaaacaacgacgggtggat
cgtattctgcgtaagttggaccaattgcaaggttcggtaactagtcgggactggcttaac
acctgggatgcaaaaacggcaatcgcccaattgaccgaagaaattcgcttttggtggcgc
acggacgagctacatcagtttaaacccaccgtattggatgaagtggactattctctgcac
tatttcgatgaggtgctgttcgatgcggtgccggaactgtccaaacgtctagggcaggcc
attaaggaaacctttccccatctgcgggctccccgggccaatttttgctatttcggttct
tgggtgggtggcgatcgggatggtaacccttcggtgaccccggaggtgacctggcaaaca
gcttgctatcagcggggcttagtgctggggaaatatctatttagtttgggggaactggtg
gccattctcagcccttccctgcactggtgcaaagtctcccaggaattgttggactctttg
gagcgggatcgcatacaactgccagaggtttatgaagaattgtccctccgttaccgtcag
gaaccctatcgcatgaaactggcctatgttacccagcggctggaaaataccctgcggcgc
aataaccgtttggctaaccccgaagagcggcaaaccatgatttctatgccagcggaaaac
cattaccgcactggcgaagaattgctggaagaattaaggatgattcaacgcaatttaacg
gaaactggtttaacctgcctggagttggaaaacctaattacccaattggaagtctatggc
tttaacctggcccaattggattttcgtcaggaatcctcccgccacgctgaggcgatcgcc
gaaattgccgaatatatgggagtgctgaccagcccctacgaggaaatgagcgaagaagat
aagttagcttggctaggggtagaattgcagacccgtcgccctttaattccccaggaaatg
cctttttctgaacggacgagggaaaccattgaaaccctccgcaccctacgtcatctacaa
atggaatttggcgtagacatttgtcagacctatatcatcagcatgaccaacgatgccagt
gacgtgttggaagtgttactcctaaccaaggaagctggactgtacgatcccgccaccgcc
tccaattccctccgcattgtgcctttgtttgaaacagtggaggatctgaaaaatgccccc
ggtattatggattcccttttcagtttgcctttttaccgggctacattggcgggcagttac
gattccctaaaagagttacaaagtcagcccccggattattaccaaattcccaccaccaaa
gcccagctaaatcccggtaacctacaagaaattatggtgggttattccgacagcaacaaa
gattctggctttttaagcagcaactgggaaattcacaaagcgcaaaaagcactccaggcg
gtggcccaaaaccatcgggtgattctgcggctgttccatggccggggaggctccgttggc
cgggggggaggtccagcctataaagcaattttggctcagccagcgggcacagtggacggc
cggatcaaaattacggaacagggggaagtgttggcgtccaaatattccctaccggaattg
gctttgtataacctagaaaccctgaccacagcagtgatccaagctagtttacttaaaagt
agttttgattttattgagccttggaaccgcattatggaggaactggcttgtaccgcccgc
caagcctaccggagtttgatttacgaagaaccggactttttagatttcttcctgacggtt
acccccattcccgaaattagtgagttacagatcagttcccgccctgctcgccgtaaggga
ggtaaagccgatctcagcagtttacgggccattccctgggtattcagttggacccaaacc
cgattcctattgccggcgtggtatggggtaggtacagcgttgaaatcctttgtggatcaa
gacccggtgaaaaacatgaaattgttgcgctacttctacttcaaatggcccttctttaac
atggtgatctcgaaggtggaaatgaccctgtccaaagtggacctcaccattgcctcccac
tatgtacaggagctatctaagccagaagaccgggaacggttcgatcgcctcttccagcag
attaagcaggaatatcaattaaccagagactttgccatggaaattacagcccatccccac
ctcctcgatggcgatcgttctttacaacgatcggtgctactgcgaaaccgcactattgtt
ccccttggtctgttacaaatttccctgcttaaaagactgcggcaagtgacccaagaagcg
gagaccagcggcgtgcgttaccgtcgttattccaaagaggaactactgcggggagcccta
ttaaccattaacggtattgcggccggaatgcgtaatactggttga

DBGET integrated database retrieval system