KEGG   Synechocystis sp. PCC 6803: slr0012Help
Entry
slr0012           CDS       T00004                                 

Gene name
rbcS
Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    slr0012 (rbcS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    slr0012 (rbcS)
Enzymes [BR:syn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     slr0012 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
2480477..2480818
Genome map
AA seq 113 aa AA seqDB search
MKTLPKERRYETLSYLPPLTDQQIAKQVEFLLDQGFIPGVEFEEDPQPETHFWTMWKLPF
FGGATANEVLAEVRECRSENPNCYIRVIGFDNIKQCQTVSFIVHKPNQNQGRY
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttacccaaagagcgccgctacgaaaccctttcttacctgccccctttaacc
gatcaacagattgctaaacaggttgagtttctgttagaccagggctttattcccggcgtg
gaatttgaagaagacccccaacccgaaacccacttctggaccatgtggaaactgcccttc
tttggtggtgccactgccaacgaagttctagccgaagtacgggaatgtcgttctgagaat
cccaactgctacattcgggtgattggtttcgacaatatcaaacagtgccagactgtaagc
tttattgtccacaaacccaaccaaaaccaaggccgttactaa

DBGET integrated database retrieval system