KEGG   Synechococcus sp. PCC 6312: Syn6312_0675Help
Entry
Syn6312_0675      CDS       T02370                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
syne  Synechococcus sp. PCC 6312
Brite
Enzymes [BR:syne01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Syn6312_0675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(675281..675970)
Genome map
AA seq 229 aa AA seqDB search
MVWCSTALASWALFPPKTLAASSPTGVYVLPPLPYAYNALEPYIDAETMEFHHDKHHAAY
VNNLNAALQKYPQWSGLRIEELLEKLDQLPNDIRQTVRNNGGGHANHSLFWESMSPAAGG
KPRGKLATAMQARFGSFEDFQAQFNSAGLKQFGSGWVWLGLGQDGTLQVFTTPNQDSPLS
QGITPLLGNDVWEHAYYLSYRNRRDQYLQAWWNVVNWDKIGERYEQATG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggtctggtgtagcacagccttggctagctgggccctatttccccctaaaactctggct
gcctcatccccgactggtgtttatgtcctgcctcctttaccctatgcctacaatgccctt
gagccttacattgatgctgaaaccatggaatttcaccatgataagcaccatgcagcctac
gtcaacaatctcaacgctgccctacaaaaatatccccagtggtctggcttgcggattgaa
gaactcctggaaaaactagaccagcttcccaatgacattcggcaaacggtcagaaataat
ggcggcggtcatgccaatcacagtttattttgggagagcatgagtccggcggcagggggc
aaacccagagggaaattagctacggcaatgcaagcccgctttggcagctttgaggatttc
caggcccagttcaatagcgcaggtctaaagcaatttggcagtggttgggtttggctaggg
ttgggccaagatggcacattacaggttttcacaacccccaatcaggatagccccctcagc
caaggcatcaccccgttgttgggcaatgatgtttgggagcacgcctactatttgtcctat
cggaatcgccgggatcaatatctccaggcctggtggaatgtggtgaattgggacaaaatc
ggagaacgctatgagcaagctacgggataa

DBGET integrated database retrieval system