KEGG   Synechococcus sp. PCC 6312: Syn6312_2009Help
Entry
Syn6312_2009      CDS       T02370                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
syne00630  Glyoxylate and dicarboxylate metabolism
syne00710  Carbon fixation in photosynthetic organisms
syne01100  Metabolic pathways
syne01120  Microbial metabolism in diverse environments
syne01200  Carbon metabolism
Module
syne_M00165  Reductive pentose phosphate cycle (Calvin cycle)
syne_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
syne_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syne00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Syn6312_2009
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Syn6312_2009
Enzymes [BR:syne01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Syn6312_2009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AFY61141
UniProt: K9RUC7
LinkDB All DBs
Position
1979093..1979440
Genome map
AA seq 115 aa AA seqDB search
MKTLPKERRYETFSYLPPLSDAQIARQIQYTIDQGYHPCVEFNESSAAEIYYWTMWKLPL
FDCSSPQEVLNEVQQCRSEYPNCYIRVVAFDNIKQCQVMSFIVHKPNQSGSGYRY
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattacccaaagagcggcgttacgaaaccttctcctatttgcctcccttgagc
gatgcccagattgcccgccaaatccagtacaccatcgaccagggctatcacccctgtgtc
gaatttaacgaaagctctgccgccgaaatttactactggacgatgtggaagttgccctta
tttgattgttcttctccccaagaagtcttgaatgaggttcaacaatgccgctcggaatac
cccaactgctatatccgggtggtcgcctttgacaacatcaaacagtgccaagtcatgagc
tttattgtgcataaacccaatcaaagtggcagtggctatcgctactaa

DBGET integrated database retrieval system