KEGG   Synechococcus sp. KORDI-100: KR100_05495Help
Entry
KR100_05495       CDS       T03344                                 

Gene name
rbcL
Definition
(GenBank) ribulose bisophosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
synk  Synechococcus sp. KORDI-100
Pathway
synk00630  Glyoxylate and dicarboxylate metabolism
synk00710  Carbon fixation in photosynthetic organisms
synk01100  Metabolic pathways
synk01120  Microbial metabolism in diverse environments
synk01200  Carbon metabolism
Module
synk_M00165  Reductive pentose phosphate cycle (Calvin cycle)
synk_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
synk_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:synk00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    KR100_05495 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    KR100_05495 (rbcL)
Enzymes [BR:synk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     KR100_05495 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AII42820
UniProt: A0A076GZE7
LinkDB All DBs
Position
1024903..1026318
Genome map
AA seq 471 aa AA seqDB search
MSKKYDAGVKEYRDTYWTPDYVPLDTDLLACFKCTGQEGVPKEEVAAAVAAESSTGTWST
VWSELLTDLDFYKGRCYRIEDVPGDKESFYAFIAYPLDLFEEGSITNVLTSLVGNVFGFK
ALRHLRLEDLRFPLAFIKTCYGPPNGIQVERDRMNKYGRPLLGCTIKPKLGLSGKNYGRV
VYECLRGGLDFTKDDENINSQPFQRWQNRFEFVAEAIKLSEQETGEKKGHYLNVTANTPE
EMYERAEFAKELGMPIIMHDFITGGFTANTGLSRWCRKNGMLLHIHRAMHAVIDRHPKHG
IHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQTTLGYIDQLRESFVPEDRSRGNFFDQDW
GSMPGVFAVASGGIHVWHMPALVTIFGDDSVLQFGGGTHGHPWGSAAGAAANRVALEACV
KARNAGRHLEKESRDILTEAAKHSPELAIALETWKEIKFEFDTVDKLDVQQ
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaagtacgacgctggggtcaaggagtacagggatacctactggactcctgat
tacgtccccctcgacaccgacctgctggcctgcttcaagtgcaccggccaggaaggtgtt
cccaaagaagaggttgccgctgctgtggctgctgaatcctccaccggtacctggtccact
gtctggtccgagctcctcaccgacctcgacttctacaagggccgttgctaccgcatcgaa
gatgttcctggcgacaaggagtccttctacgccttcatcgcctaccccctcgatctgttc
gaagagggttcgatcaccaacgttctgacctccttggtcggcaacgtcttcggcttcaag
gccctgcgccacctacgcctcgaagacctgcgcttcccgctcgccttcatcaagacctgc
tatggcccgccgaatggcatccaggtcgagcgtgaccggatgaacaagtacggacgtcca
ctgctgggttgcaccatcaagccgaagctcggcctgagcggtaagaactacggccgtgtt
gtctatgagtgcctgcgtggtggtctcgacttcaccaaggacgacgagaacatcaactcc
cagcccttccagcgttggcagaaccgcttcgaattcgtcgcggaagccatcaagctttca
gagcaggaaacaggcgagaagaagggtcactatctcaacgtgaccgccaacacgcctgaa
gagatgtatgagcgcgctgagttcgccaaggaactcggaatgccgatcatcatgcacgac
ttcattaccggtggcttcacggccaacaccggtctgtcgaggtggtgccgcaagaacggc
atgctgctgcacatccaccgcgccatgcacgcggtgatcgaccgtcaccccaagcacggc
atccacttccgcgtcctcgccaagtgtctgcgtctctccggcggtgaccagcttcacacc
ggcactgtggtcggaaaactggaaggtgatcgtcagaccaccctcggttatatcgatcaa
ctgcgtgaatccttcgttcccgaagatcgcagccgcggcaacttcttcgatcaggactgg
ggttccatgcctggtgtgttcgccgttgcatccggcggtattcacgtctggcacatgccg
gccctggtcacgatcttcggcgacgactccgttcttcagttcggtggtggtacccacggt
cacccctggggctcagctgcaggtgctgctgccaaccgtgtggccctcgaggcctgcgtc
aaggcacgcaacgccggtcgccatctcgagaaagagagccgcgacatcctcaccgaggcc
gcgaagcacagccccgagctggcgattgctctcgagacctggaaggaaatcaagttcgaa
ttcgacaccgtcgacaagctcgacgttcagcagtga

DBGET integrated database retrieval system