KEGG   Synechococcus sp. PCC 7502: Syn7502_00631Help
Entry
Syn7502_00631     CDS       T02371                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
synp  Synechococcus sp. PCC 7502
Pathway
synp00010  Glycolysis / Gluconeogenesis
synp00020  Citrate cycle (TCA cycle)
synp00620  Pyruvate metabolism
synp01100  Metabolic pathways
synp01110  Biosynthesis of secondary metabolites
synp01120  Microbial metabolism in diverse environments
synp01130  Biosynthesis of antibiotics
synp01200  Carbon metabolism
Module
synp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:synp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syn7502_00631
   00020 Citrate cycle (TCA cycle)
    Syn7502_00631
   00620 Pyruvate metabolism
    Syn7502_00631
Enzymes [BR:synp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Syn7502_00631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase
Motif
Other DBs
NCBI-ProteinID: AFY72780
UniProt: K9SRK8
LinkDB All DBs
Position
complement(645860..647152)
Genome map
AA seq 430 aa AA seqDB search
MIYEIFMPALSSTMTEGKITAWVKSIGDKVEKGETVLVVESDKADMDVESFYEGYLGAIA
VPAGETAPVGSTLGYVAETVAEIADIKSKLSQTSEPVAASTNGTSTGTAIPEVVVTKVET
PAIAKSDRLIATPRAKRIAKENNLDLAKINGSGPNGRITEQDVTALLQVPVQATPAKVSV
KAPEPIAASIPSAPVSTTPKVTYTPQLGTTKPLTTLQNAVVRNMNASLSVPTFHVGYTIT
TTGLDELYKQIKSKGVTITALLAKAVAVTLQRHPIVNASFSDQGIVYKSDINVAIAVAME
DGGLITPVLPKANESDIYSLSRHWKSLVERARAKQLQPEEYNSGTFTISNLGMFGVDRFD
AILPPNTGAILAIGASHPQVVATKDGAIAVRNQMQVNLTADHRIIYGADAAKFLQDLAKL
LETDAQSLVL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgatctacgaaattttcatgcccgctttaagttccacgatgaccgagggtaaaatcacg
gcttgggttaaatccattggcgacaaagtagaaaagggtgaaaccgtcttagttgtggaa
tctgataaggcagatatggatgtggaaagcttctatgaaggctatttaggggcgatcgcc
gtacctgcgggagaaactgcacccgtaggtagtaccctaggctatgtggcagaaacagtt
gccgaaattgctgatattaagtccaaactaagccaaacctctgagccagttgcggcttct
actaacggcactagtactggcacagctattcctgaagtagtggttactaaggttgaaacc
ccagctatagccaaaagcgatcgtctaattgccactcctagagcaaaacgcattgctaaa
gaaaataacctagacctagctaaaattaacggttctggacccaatggcagaattactgag
caagatgttactgccctgttgcaagttccagttcaagccacccctgctaaagtatcagta
aaggcacctgaaccgatcgctgcgtcaattccctctgccccagtttccaccactcccaaa
gtcacctatacgcctcaactgggaactactaaacccctcacaactctgcaaaatgctgta
gtgcgtaacatgaatgccagtttaagtgttccgacttttcatgtgggctataccatcacc
accactggtttagatgaactttacaagcagattaaatctaaaggtgtaaccataacagct
ctgttagcaaaggcggtagcagtgaccctccaaaggcatcccatagttaatgctagtttt
agtgatcagggtatcgtttataaatccgatattaatgtggcgatcgccgtagccatggaa
gatggtggtttaattacacccgtgctacctaaggcaaacgaaagtgatatttacagccta
tcccgtcactggaaatcccttgtggaaagggcaagagccaaacaactgcaaccagaagaa
tataattcgggaactttcactatttccaatttaggtatgtttggagtagatcgatttgat
gctatcttgccaccaaatacaggtgcgatcttagctatcggtgcatctcatccccaagtg
gttgctaccaaagacggagcgatcgcagtgcgcaatcaaatgcaagttaacctgactgcc
gatcaccgcattatctatggtgctgatgccgccaagtttttacaagaccttgctaaatta
ctggaaaccgatgctcaatccttagttctataa

DBGET integrated database retrieval system