KEGG   Synechococcus sp. KORDI-49: KR49_12850Help
Entry
KR49_12850        CDS       T03345                                 

Gene name
rbcL
Definition
(GenBank) ribulose bisophosphate carboxylase
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
synr  Synechococcus sp. KORDI-49
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:synr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    KR49_12850 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    KR49_12850 (rbcL)
Enzymes [BR:synr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     KR49_12850 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2358925..2360340
Genome map
AA seq 471 aa AA seqDB search
MSKKYDAGVKEYRDTYWTPDYVPLDTDLLACFKCTGQEGVPKEEVAAAVAAESSTGTWST
VWSELLTDLDFYKGRCYRIEDVPGDKESFYAFIAYPLDLFEEGSITNVLTSLVGNVFGFK
ALRHLRLEDLRFPLAFIKTCYGPPNGIQVERDRMNKYGRPLLGCTIKPKLGLSGKNYGRV
VYECLRGGLDFTKDDENINSQPFQRWQNRFEFVAEAIKLSEQETGEKKGHYLNVTANTPE
EMYERAEFAKELGMPIIMHDFITGGFTANTGLSKWCRKNGMLLHIHRAMHAVIDRHPKHG
IHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQTTLGYIDQLRESFVPEDRSRGNFFDQDW
GSMPGVFAVASGGIHVWHMPALVTIFGDDSVLQFGGGTHGHPWGSAAGAAANRVALEACV
KARNAGRHLEKESRDILMEAAKHSPELAIALETWKEIKFEFDTVDKLDVQG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaagtacgacgctggggtcaaggagtacagggacacttactggactcctgat
tacgttcccctcgacaccgacctgctggcctgcttcaaatgcaccggccaggaaggcgtt
cccaaggaggaagtggccgctgctgtggctgctgaatcctccaccggcacctggtccact
gtgtggtccgagctcctcaccgatctcgacttctacaaaggccgctgctaccgcatcgag
gacgtccctggtgacaaggagtccttctacgccttcatcgcctaccccctcgacctgttc
gaggaagggtccatcaccaacgttctgacctcactggtcggcaacgtgttcggcttcaag
gccctgcgccacctgcgtctcgaagacctgcgcttcccgctggccttcatcaagacctgc
tacggcccgccgaacggcatccaggtcgagcgcgaccggatgaacaagtacggccgtcct
ctgctgggttgcaccatcaagccgaagctcggcctgagcggtaagaactacggccgtgtc
gtctatgagtgccttcgcggcggtctggacttcaccaaggacgacgagaacatcaactcc
cagccgttccagcgttggcagaaccgcttcgaattcgttgcggaagccatcaagctgtcc
gagcaggagaccggcgagaagaagggtcactacctcaacgtgaccgccaacactcccgag
gagatgtacgagcgcgctgagttcgccaaggaactcggcatgccgatcatcatgcacgac
ttcatcaccggcggcttcacagccaacaccggtctgtcgaagtggtgccgcaagaacggc
atgttgctgcacatccaccgcgccatgcacgcggtgatcgaccgtcatcccaagcacggc
attcacttccgcgtcctcgccaagtgtctgcgtctgtccggtggtgaccagctccacacc
ggcaccgtggtcggcaagctcgagggtgaccgtcagaccaccctcggctacatcgaccag
ctgcgcgaatcgttcgtgcccgaagaccgcagccgcggcaacttcttcgatcaggactgg
ggctccatgcccggcgtgttcgccgtcgcctccggcggtatccacgtgtggcacatgccc
gccctggtcaccatcttcggcgacgactccgttctgcagttcggtggtggtacccacggt
cacccctggggttccgctgcaggtgctgcggccaaccgcgtggccctcgaggcctgcgtc
aaggcccgcaacgccggccgccatctcgagaaagagagccgcgacatcctcatggaagcc
gctaagcacagccccgagctggcgatcgccctcgagacctggaaggagatcaagttcgag
ttcgacaccgtcgacaagctcgacgttcagggctga

DBGET integrated database retrieval system