KEGG   Synechococcus sp. WH 8103: SynWH8103_02354Help
Entry
SynWH8103_02354   CDS       T04859                                 

Gene name
ppc
Definition
(GenBank) Phosphoenol pyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
synw  Synechococcus sp. WH 8103
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:synw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SynWH8103_02354 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SynWH8103_02354 (ppc)
   00680 Methane metabolism
    SynWH8103_02354 (ppc)
Enzymes [BR:synw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SynWH8103_02354 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1915798..1918830
Genome map
AA seq 1010 aa AA seqDB search
MINRSPETSGASMPQSTAHVPDGEQPRASGGSPGAGRLLQHRLELVEDLWQTVLRSECPP
EQSERLLRLKQLSDPVALEGRDGESSSEAIVELIRSMDLSEAIAAARAFSLYFQLINILE
QRIEEDSYLDSLRPSRSQDDETAAPFDPFAPPLASQTDPATFGEVFERLRRMNVPPAQVE
TLLRELDIRLVFTAHPTEIVRHTVRHKQRKVASLLQRLQSEPALPRYDEEELRRQLEEEI
RLWWRTDELHQFKPTVLDEVDSTLHYFQQVLFEAMPQLRRRLVSSLSRHYPDVQFPQASF
CTFGSWVGSDRDGNPSVTPEITWRTACYQRQLMLELYIGSVQSLRNQLSISMQWSQVAPP
LLESLEMDRLRFPEIYERRAARYRLEPYRLKLSYILERLELTLQRNHQMSEAGWQSPPEP
AATAPTDGIPGHEALHYTAIDQFRSDLELIRNSLVSTELSCEQLDTLLNQVHIFGFSLAS
LDIRQESTRHSDAIDELTTHLQLPKAYGAMEESERVAWLLEELQTRRPLIPAAVEWSEAT
AQTFAVFQMLHRLQQEFGQRICHSYVISMSHTASDLLEVMLLAKEIGLVDPQAGKASLLV
VPLFETVEDLQRAPAVMDGLFQTPIYRNLLPSVGVQRQPLQELMLGYSDSNKDSGFLSSN
WEIHQAQIALQTLASSHGVALRLFHGRGGSVSRGGGPAYQAILAQPSGTLQGRIKITEQG
EVLASKYGLPELALYNLETVTTAVVQNSLVTNQLDATPSWNQLMSRVAKRSREHYRALVH
DNPDLVAFFQQVTPIEEISKLQISSRPARRKTGARDLSSLRAIPWVFGWTQSRFLLPSWF
GVGTALAEEVNDDPEQLDLLRRLHQRWPFFRMLISKVEMTLSKVDLDLAHHYMSSLGNPE
QRDAFEGIFKVIADEYGRTLKLVLEITGQSRLLGADQNLQLSVDLRNRTIVPLGFLQVAL
LRRLRDQNRQPPMSESPGTPEDRRTYSRSELLRGALLTLNGIAAGMRNTG
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatcgcagtcccgagaccagcggagcgtcgatgccccagtccaccgcccatgtc
cccgacggcgagcagccaagggccagcggtggcagccccggcgccggccgcctgctgcag
catcgcctcgagctggtggaagacctgtggcagaccgtgctgcgcagcgaatgccccccg
gaacaaagcgagcgactgcttcgcctcaagcagctgagtgatccggtggccctggaaggc
cgcgacggtgagagcagcagcgaggcgatcgttgagctgatccgcagcatggatctctcc
gaggccatcgcagcagcccgtgctttctcgctgtatttccagctgatcaacatcctcgag
cagcgcatcgaagaagacagctatctcgacagccttcgtcccagccgcagccaggacgac
gagaccgcggcgccctttgatcccttcgcgccgcccctggccagccagaccgaccccgcc
acattcggcgaggtgttcgagcggctgcggcggatgaacgttccccccgcgcaggtggag
acgctcctgcgggaactggacatccgactggtgttcaccgcccacccgacggaaatcgtg
cggcacaccgtgcggcacaaacagcggaaggtggcctccctgctgcagcggttgcagtca
gagccagcgctgccccgctacgacgaagaggaattgcgacgccagctggaggaggagatc
cgcctctggtggcgcaccgatgagctgcaccagttcaaaccgacggtgctggatgaggtg
gattcaaccctgcactacttccagcaggtgctgttcgaggcgatgccgcagctgcggagg
cggctggtgtcatccctgagccggcactaccccgatgtgcagttcccccaggcgtccttc
tgcaccttcgggtcctgggtggggtccgaccgcgacggcaacccctcggtcaccccggag
atcacctggcggaccgcctgttatcagcgccagctgatgctggagctctacatcggctcg
gtgcaatccctgcgcaaccagctgagcatctcgatgcagtggagccaggtggccccacca
ctgctggaatcgctggaaatggaccggctgcgcttcccggaaatctatgagcgccgggcc
gcccgctatcggctggagccctaccggctcaagctcagctacatcctcgaacggctggag
ctcacgctgcagcgcaaccatcagatgtcggaggctggctggcagtcgccgcccgaaccc
gccgccacagcgccaaccgatgggatcccgggccatgaggcgctgcactacaccgccatc
gatcagttccgcagtgatctggaactgatccgcaacagcctcgtcagcaccgagctgagc
tgcgaacagctcgacaccctgctcaatcaggtccacatcttcgggttctccctggcgagc
ctggacatccggcaggagagcacccgccacagcgacgccatcgatgagctgaccacccac
ctgcagcttccaaaggcctacggcgccatggaggaatccgagcgggtggcctggctgctg
gaggaactgcagacccgccggccgctgatccccgcggcggtcgaatggtccgaagccacc
gcccagacctttgcggtgttccagatgctgcatcgcctgcagcaggaattcggtcagcgg
atctgccactcctacgtgatctccatgagtcacaccgcctccgacctgctggaggtgatg
ctgctggcgaaggagatcggccttgtggacccgcaggccggcaaggcatcgctgttggtg
gtacccctgttcgaaacggtggaagacctgcagcgggccccagcggtgatggacggcctg
ttccagacgccgatctaccggaatctgctccccagtgtcggcgtccagcgacagcccctg
caggagctgatgctcgggtactccgacagcaacaaggactcgggcttcctctccagcaac
tgggagattcaccaggcgcagatcgccctgcaaaccctggccagcagccacggtgtggcc
ctacggctgttccacggccggggtggatcggtgagccgcggcggcggcccggcctaccag
gccatccttgcccagcccagcggcacactgcagggccggatcaagatcaccgaacagggt
gaggtgctggcctccaagtacggcctgccggaacttgccctttacaacctggaaaccgtc
acgacggcggtggtgcagaacagcttggtgaccaaccagctggatgccaccccgagctgg
aaccagttgatgagccgcgtggccaaacgctcccgcgagcattaccgggccctggtccac
gacaaccccgatctggtggcgtttttccagcaggtcaccccgatcgaggagatcagcaag
ctgcagatctccagccgtccggctcgccgcaagaccggcgcccgggatctctccagtctg
cgggcaatcccctgggtgttcggctggacccaaagccggttcctgctgccgagctggttc
ggtgtgggcaccgccctggcggaggaggtcaacgacgaccctgagcaactggacctgctg
cggcgactgcatcagcgctggccgtttttccggatgctgatttccaaggtggagatgacg
ctgtccaaggtcgatctcgacctggcgcaccactacatgagcagcctcggcaacccggag
cagcgcgatgcctttgaaggcatcttcaaggtgatcgccgatgaatacggccgcaccctg
aagctggtgctcgaaatcaccggtcagagccgcctgctgggggccgatcagaacctgcag
ctgtcggtggatctgcgcaaccgcaccattgttcccctgggcttcctgcaggtggccctg
ctgcggcgactgcgggatcagaaccgccagcctcccatgagcgaatcccctggaacgccg
gaggaccgccgcacctacagccgcagtgaactgctgcggggcgcattgctcaccctcaac
ggcatcgccgccggcatgcgcaacaccggctga

DBGET integrated database retrieval system