KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A1796Help
Entry
SYNPCC7002_A1796  CDS       T00664                                 

Gene name
rbcS
Definition
(GenBank) Ribulose bisphosphate carboxylase, small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
syp  Synechococcus sp. PCC7002
Pathway
syp00630  Glyoxylate and dicarboxylate metabolism
syp00710  Carbon fixation in photosynthetic organisms
syp01100  Metabolic pathways
syp01120  Microbial metabolism in diverse environments
syp01200  Carbon metabolism
Module
syp_M00165  Reductive pentose phosphate cycle (Calvin cycle)
syp_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
syp_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SYNPCC7002_A1796 (rbcS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SYNPCC7002_A1796 (rbcS)
Enzymes [BR:syp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SYNPCC7002_A1796 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small DUF772 PAS_4
Motif
Other DBs
NCBI-ProteinID: ACA99784
CyanoBase: SYNPCC7002_A1796
CYORF: SYNPCC7002_A1796
UniProt: Q44178
LinkDB All DBs
Position
complement(1881910..1882245)
Genome map
AA seq 111 aa AA seqDB search
MKTLPKEKRYETLSYLPPLSDQQIARQVQYMMDQGYIPGIEFEKDPTPELHHWTLWKLPL
FNASSAQEVLNEVRECRSEYSDCYIRVVGFDNIKQCQTVSFIVYKPNQTRY
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttacctaaagaaaagcgttacgaaactctttcttacttgccccccctcagc
gaccagcaaatcgctcgccaagtccagtacatgatggatcaaggctatattcctggtatc
gagttcgaaaaagatccgactcctgaactccaccactggacactgtggaagctgcccctt
ttcaacgcaagctctgctcaagaagtactcaacgaagtgcgtgagtgccgtagtgaatat
tctgactgctacatccgtgttgttggtttcgacaacatcaagcagtgccaaaccgttagc
ttcatcgtttacaagcccaaccaaacccgttactaa

DBGET integrated database retrieval system