KEGG   Synechococcus sp. RCC307: SynRCC307_1791Help
Entry
SynRCC307_1791    CDS       T00523                                 

Gene name
sodB
Definition
(GenBank) Superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
syr  Synechococcus sp. RCC307
Brite
Enzymes [BR:syr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SynRCC307_1791 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CAK28694
CyanoBase: SynRCC307_1791
CYORF: SynRCC307_1791
UniProt: A5GUY5
LinkDB All DBs
Position
1555535..1556134
Genome map
AA seq 199 aa AA seqDB search
MAHTLPVLPYALDALEPHISRQTLEFHHGKHHAGYVNNLNKLVEGTDLDGKSIEDTITAV
AGNAEKAGVFNNAAQVWNHSFYWQCIKPGGGGQPTGALADKINADFGSFEKFIEAFKAAG
ATQFGSGWAWLVLDNGTLKVTKTANADLPLAHGQKALLTMDVWEHAYYLDYQNRRPDYIT
TYLEKLVNWDFVAANFAAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcccacaccctccctgttctgccttacgcgctcgatgctctcgagcctcatatctcc
cgccagaccctggagtttcaccacggcaagcaccacgctggctacgtgaacaacctcaac
aagcttgtggaaggcaccgatctcgacggcaagagcatcgaggacaccatcaccgccgtg
gccggtaacgccgagaaggctggcgtgttcaacaacgccgcccaggtgtggaaccacagc
ttctactggcagtgcatcaagcccggtggcggcggccagcccaccggcgccctggccgac
aaaatcaacgctgacttcggcagctttgagaagttcatcgaagctttcaaagccgctggc
gccacccagttcggcagcggttgggcctggctggtgctcgacaacggcaccctcaaggtg
accaagaccgccaacgccgatctgcccttggctcacggccagaaggctctgctcaccatg
gatgtctgggagcacgcttactacctggattaccagaaccgccgccccgattacatcacc
acctacctcgagaagctggtgaactgggacttcgtggctgccaacttcgccgctgcctga

DBGET integrated database retrieval system