KEGG   Synechococcus sp. RCC307: SynRCC307_1794Help
Entry
SynRCC307_1794    CDS       T00523                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syr  Synechococcus sp. RCC307
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SynRCC307_1794 (pdhC)
   00020 Citrate cycle (TCA cycle)
    SynRCC307_1794 (pdhC)
   00620 Pyruvate metabolism
    SynRCC307_1794 (pdhC)
Enzymes [BR:syr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SynRCC307_1794 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
complement(1559215..1560549)
Genome map
AA seq 444 aa AA seqDB search
MATFEIFMPALSSTMTEGKIVEWLKQPGDRVERGESVLVVESDKADMDVESFEAGFLGAV
LLPAGGTAPVGETIGLVVETEAELAELKANGPAKPAASAPAAAPAPAPAAAPPAAPEPAP
APTPAPVAVAAPPAPASSNGHGGRVVASPRAKKLAQQLGVQLEGLRGSGPHGRLIAADIE
RAAGRTPTAPAAVPAGTLTAAQAAAPAVAPLPAAVAAPVAPGETLPFTTLQQAVNRNMVA
SLAVPTFRVGYTITTDKLDAFYKQVKPKGVTMTALLAKAVASALAGHPRVNAAFSEAGIA
YPEGINVAVAVAMEDGGLVTPVLAAADRNDLYSLSRSWADLVSRARSKQLKPEEYSTGTF
TLSNLGMFGVDRFDAILPPGTGAILAVGASRPVVAANSDGSIAVKRQMQVNLTADHRVIY
GADAAGFLKDLAKIIETQPESLAL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcgacattcgagatcttcatgccagccctcagctcaacgatgactgaggggaagatc
gttgagtggctcaagcagcccggcgaccgcgtcgagcgcggtgaatcggtgttggtggtc
gagtccgataaggccgacatggacgtggagtcctttgaagccggcttcctcggtgctgtg
ttgctgcccgctggcggcacagcgcctgtgggcgaaaccatcggtttggtggtggaaacc
gaggctgagctcgccgaactcaaggccaacggcccagccaaaccagccgcttctgcgcct
gcagcagcaccggccccagcaccagctgctgcacccccagcggcccctgagcccgccccc
gcgccaacccctgcgccggttgccgtggccgctccgcctgcccctgccagcagcaatggc
catggcggacgtgtcgtggcgagcccccgcgccaagaaactggcccagcaattgggcgtg
caactcgagggcctgcgcggcagcggcccccatggccgcctgatcgctgctgatatcgag
cgtgctgccggtcgcacccccaccgcgccagcggctgttccagctggaaccctgacggcg
gcgcaagctgctgcccctgctgtggctccgctgccagcagctgtggctgccccagtagcg
cctggtgaaaccctgcccttcaccaccttgcagcaggcggtcaaccgcaacatggtggcc
agcctggcggtgcccaccttccgcgtcggctacacgatcaccaccgacaagctcgacgcc
ttctataagcaggtcaagcccaagggcgtgaccatgaccgcacttttggccaaggctgtg
gcgtctgctctggccggccaccccagggtgaatgcggccttcagcgaggccggcatcgct
tatccagagggcatcaatgtggccgtagctgtggccatggaagacggcggcttggtgacc
ccggtgctggccgccgctgatcgcaacgacctttacagcctctcgcgcagctgggctgat
ctggtctctcgggcccgcagcaagcagttgaagcctgaggaatacagcactggcaccttc
accctctccaatctgggcatgtttggtgtcgaccgctttgacgcgatcctgccgccaggc
accggcgcaatcctggctgtgggtgcctcacgtccagtggtggccgccaacagcgatggc
tcgatcgccgtcaagcgccagatgcaggtcaacctcaccgcagaccaccgcgtgatctac
ggcgctgatgctgccggcttcctcaaggatctggccaagatcatcgaaacccagcccgaa
agcctggcgctttga

DBGET integrated database retrieval system