KEGG   Synechococcus sp. RCC307: SynRCC307_2090Help
Entry
SynRCC307_2090    CDS       T00523                                 

Gene name
ppc, pepC
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
syr  Synechococcus sp. RCC307
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SynRCC307_2090 (ppc)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SynRCC307_2090 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SynRCC307_2090 (ppc)
   00680 Methane metabolism
    SynRCC307_2090 (ppc)
Enzymes [BR:syr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SynRCC307_2090 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
1807023..1810001
Genome map
AA seq 992 aa AA seqDB search
MIETSSTASTSRMPASQTETVQPVGRRTLRQLNERLELVEELWGNVLRSECPPEQAARVL
QLKQLCREDETSDQIIDLIVAMDLSEAIAAARAFSLYFQLVNILEQHIEEDRYLATMSQD
NIAEAAISDTLNGHLANHDQPATFQRLFQRLRALNVPPGLLEPLLRELDVRLVFTAHPTE
IVRHTVRHKHRRVAHLIQRLEGLNDENDSFDDRQGLRQQLLEEIRVWWRTDELHQFKPSV
LDEVDYALHFFQQVLFQAMPLLHERIRKALKDSYPDVTPPEDGFCTFGSWVGSDRDGNPS
VTPEITWRTACYQRQLMLERYLSSVRNLRNQLSISMQWSQVSPALLESLEMDRLRFPEIY
EKLAARYRLEPYRLKLCYVLQRLELTHERNAQLSELGWESPLSATEPEEQTLSSSLTPQQ
ELHYSTYQDFRSDLELVRTSLEATGLSCEPLNRLLSQVQIFGFCLASLDIRQESTRHSEA
LAELTRYLQLPQDYEAMEEPQRVEWLLEQLQTRRPLIPTGPLWSDATAETFAVFQMLRRL
QEEFGQRICRTYVISMSHTESDLLEVLLLAKEAGLVDPVEGTTRLQVIPLFETVEDLRCA
PEVMGAVMARPFYKRLLANEEVPLQEVMLGYSDSNKDSGFLSSNWEIHRAQIALQSLCSE
HNISLRIFHGRGGSVSRGGGPAYQAILAQPSGTLKGRIKITEQGEVLASKYALPELALYN
LETVTTAVLQNSLLSSGVDDTPSWNELMERLASRSRQHYRALVHEHPDLVAFFEQVTPIE
EISKLQISSRPARRRTGARDLSSLRAIPWVFGWTQSRFLLPSWFGVGAAIREELGDDGEQ
LDTLRTLYQRWPFFRMLISKVEMTLAKVDLSLAKYYVDSLGSADRADAFQEIFATIAAEY
SLTKELVLKITGHERLLDGDPPLQLSVELRNRTIVPLGFLQVALLRRLRNQNRQPPMNES
DLSDTRTYSRGELLRGALLTINGIAAGLRNTG
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaacgtcttccactgcttcgacctcgcgcatgccggcttcgcagaccgagaca
gtccagcccgtcggtcgccgcacgctgcgtcagctgaacgaacgcttggagctggtcgaa
gagctgtggggcaacgtgctgcgcagcgaatgcccgcctgagcaggccgcacgagtgctt
cagctcaagcagctctgccgcgaagacgagacctccgatcagatcatcgacctgatcgtg
gcgatggatctctcggaagcgatcgctgctgccagggctttttccctctatttccaactg
gtcaacatcctcgagcagcacatcgaggaagaccgctacctggccacgatgagccaggac
aacatcgcggaagccgcgatcagcgacaccctcaatggccacctggccaaccacgaccag
cccgccaccttccagcggctgttccagcggctgcgcgccctcaatgtgccccccgggcta
ctcgagcccctgctgcgggagcttgatgtgcggctggtgtttaccgcgcaccccaccgag
attgttcgccacacggtgcgccacaagcaccgccgcgtcgcccatctgattcagcgcctg
gaagggttgaacgacgaaaacgacagctttgatgatcgccaggggttgcgccagcagctg
ctcgaagagatccgcgtctggtggcgcaccgatgaactgcatcagttcaaaccatcggtg
ctcgatgaggtggattacgccctgcacttcttccagcaggtgctgttccaggcgatgcca
ctgctgcatgaacgcatccgcaaggcactgaaggactcctatcccgatgtgacaccgccg
gaagacgggttctgcaccttcggctcatgggtgggctccgaccgcgatggcaacccctcg
gtcacaccggagatcacctggcgcaccgcctgttaccagcgccagttgatgctggagcgc
tacctgagctcggtgcgcaacctgcgcaaccagctgagcatttccatgcaatggagccag
gtgagtccggcactgctggagtccctcgagatggaccggctgcggttcccggagatctac
gaaaaactggcggctcgctaccgccttgagccctaccggctgaagctctgctacgtgctg
cagcgcctggagctcacccacgagcgcaacgcgcaactgtctgaattgggctgggaatct
cccctcagcgccaccgaaccggaggaacagaccctcagcagcagcctgaccccacagcag
gagctgcactacagcacctaccaggacttccgaagtgatctggaactggttcgcaccagc
ctggaagccaccggcttgagctgcgaaccgctgaatcgcctgctcagccaggtgcagatc
tttgggttctgtctggcctccctcgatattcgccaggagagcacccgccatagcgaagcc
cttgccgagctcacccgctacctgcaactacctcaggactatgaggccatggaggagcct
cagcgggtggagtggctgctggagcagctgcaaaccaggcggccactgattcccaccggt
ccgctttggagtgatgccacggcggaaacctttgccgtcttccaaatgctgcggcggctc
caggaggaatttgggcagcggatttgccgcacctatgtgatctccatgagtcacacggag
tcggatctgctggaggtgctgctgctagccaaagaggccggcttggtggatccggtggaa
ggcaccacacgcctgcaggtgattccactgtttgaaacggtggaagacttgcgctgcgcc
cctgaggtgatgggcgctgtgatggctcgccccttctacaagcgactgctcgccaacgag
gaggtgccgctgcaggaggtgatgctcggctactccgatagcaacaaagactccggcttc
ctctccagcaactgggaaatccaccgggcccaaatcgccctgcaatcgctgtgcagtgag
cacaacatcagcctgcgcatcttccacggacgcggcggctcggtgagccgtggtggtggc
ccggcgtatcaagcgatcctggcccagccgagcggcaccctcaaaggccggatcaagatc
accgaacaaggggaggtgctggcctcgaagtacgccctgccggaactagcgctctacaac
ctcgagacggtaaccaccgctgtgcttcaaaacagcttgctctccagtggcgtggacgac
acccccagctggaatgagctgatggaacggctggcttcacgctcgcgtcagcactaccgc
gccctggtgcatgagcacccggatctggtggccttctttgagcaggtcaccccgattgaa
gaaatcagcaagctgcaaatcagctcgaggccggcacggcgccgcacgggcgcccgggat
ctgtcctcactgcgggccattccttgggtgttcggctggacccaaagccgcttcctgctg
cccagctggtttggtgtgggcgccgccatccgcgaggaattgggtgacgacggtgagcag
ctcgacaccctgcgcaccctctaccagcgctggcccttcttccgcatgctgatcagcaag
gtggagatgaccctggcgaaggtggacctgtccttggcgaagtactacgtcgactccctt
ggcagtgctgaccgcgccgatgccttccaagagatcttcgccaccatcgctgccgagtac
agcctcaccaaggagctggtgctcaagatcaccggccatgaacgactgctcgatggcgac
ccaccgctgcaactctcggtggagttgcgcaatcggacgatcgtgcccctgggctttttg
caagtggccctgctgcggaggctccgcaaccagaaccgccagccccccatgaatgaatcc
gatctgagcgatacgcgcacctacagccggggtgagctgctgcgcggtgccttgctcacc
atcaacggaattgccgctggcctgcgcaacaccggttga

DBGET integrated database retrieval system