KEGG   Synechococcus sp. UTEX 2973: M744_05060Help
Entry
M744_05060        CDS       T03581                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
syu  Synechococcus sp. UTEX 2973
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    M744_05060
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    M744_05060
   00680 Methane metabolism
    M744_05060
Enzymes [BR:syu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     M744_05060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
942528..945551
Genome map
AA seq 1007 aa AA seqDB search
MSAALQSSDDAFRTVSSPLATDLDLSSPLEFFLRHRLTVVEELWEVVLRQECGQELVDIL
TQLRDLTSPEGQAPEVGGEALVQVIETLELSDAIRAARAFALYFQLINIVEQHYEQTQYQ
LAYERSRLEPLPGPDESPEGLHTIEIPQHQLDPFAAVIPLNQDPATFQTLFPRLRQLNVP
PQMIQELTDRLDIRLVFTAHPTEIVRHTIRDKQRRIAYLLRQLDELETGKNRGFRELEAQ
NIRQQLTEEIRLWWRTDELHQFKPTVLDEVDYALHYFQEVLFEAIPLLYQRFRLALQGTF
PDLQPPRYNFCQFGSWVGSDRDGNPSVTSAVTWQTACYQRSLVLDRYITAVEHLRNVLSL
SMHWSEVLPELLSSLEQESMLFPETYEQLAVRYRQEPYRLKLSYILERLHNTRDRNTRLQ
QQQEKDPTTPLPEYRDGTLYQAGTAFLEDLKLIQHNLKQTGLSCYELEKLICQVEIFGFN
LVHLDIRQESSRHSDAINEICEYLQILPQPYNELSEAERTAWLVQELKTRRPLVPARMPF
SESTREIIETLRMVKQLQEEFGEAACQTYIISMSRELSDLLEVLLLAKEVGLYDPVTGKS
SLQVIPLFETVEDLQNAPRVMTALFELPFYTQLNPTQSEPLQEVMLGYSDSNKDSGFLSS
NWEIHKAQKALGTVARDHRVKLRIFHGRGGSVGRGGGPAYEAILAQPGRTTDGRIKITEQ
GEVLASKYALPELALYNLETITTAVIQSSLLGSGFDDIEPWNQIMEELAARSRRHYRALV
YEQPDLVDFFNQVTPIEEISKLQISSRPARRKTGKRDLGSLRAIPWVFSWTQSRFLLPSW
YGVGTALQEFLQERPEQNLNLLRYFYEKWPFFRMVISKVEMTLAKVDLQIAHHYVHELAN
PEDQERFERVFSQIAAEFQLTCHLVLTITNHGRLLDGDPELQRSVQLRNGTIVPLGFLQV
ALLKRLRQYRQQTETTGLMRSRYSKGELLRGALLTINGIAAGMRNTG
NT seq 3024 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgctctccagtcatccgacgatgctttccgaaccgtttcgagtcccctcgcc
acggatttggatctgtcgtctccgctggagtttttccttcgccatcgcttgacggtggtt
gaagaactctgggaagtggttttgcgccaagagtgcggccaagagctggtcgatattctg
actcagctgcgtgacttgacctcgccggaaggccaagccccagaagtgggcggcgaagcc
ttggttcaggtgattgaaaccctagagttgagcgatgcgattcgggctgcccgtgccttt
gcgctctactttcagctgatcaatattgttgagcagcactacgagcaaactcaatatcaa
ctcgcctacgagcgatcgcggttggaacccttgccaggaccagatgaaagtccggaggga
ttgcacaccattgaaattcctcagcatcagctcgatccctttgctgcggtgattccgctc
aaccaagatccggcaaccttccaaacgctgttcccgcgcctgcgccagctcaatgtgccg
ccgcaaatgatccaagagctgaccgatcgcctcgatattcggctggttttcaccgctcac
ccgacggaaattgtccgccacacgattcgcgacaaacaacgccgaattgcctacctgctg
cggcaactggatgagctcgaaacaggcaaaaaccgaggctttcgagagcttgaagcgcag
aatattcgtcagcagctgaccgaggagattcggctctggtggcggacggatgagctccac
cagttcaagccaacggtgttggatgaggtggactacgcgctccactacttccaagaagtc
ctctttgaggccattcctctgctctatcagcgctttcggctcgcgctgcaggggactttc
cccgacctacaaccgccccgctacaacttctgccagttcggctcttgggtcggctccgat
cgcgatggcaatccttcagtgacctctgccgtcacttggcaaaccgcttgctatcagcgc
agtctcgtcctcgatcgctacatcacagcggttgaacatctccgcaatgtgctcagcctc
tcgatgcactggagcgaggtgctgccggagttgctcagctcgttggaacaggagagcatg
ctcttcccggagacctatgagcagctagcggtccgctatcgccaagagccctatcgcctc
aagctctcctatattctggagcgcctgcacaacacccgcgatcgcaatacccgcctccaa
cagcagcaagaaaaagatcccaccacgcccctgcccgaatatcgggatggcaccctctac
caggctggtacggcctttctcgaagatctcaagctgattcagcacaaccttaagcagacg
ggactgagctgttacgagctagagaagttgatctgccaggtcgagatctttggtttcaac
ctggtccatctcgacattcgccaagaaagctcgcgccattccgacgcgatcaacgaaatc
tgtgaatacctccaaattcttccccagccctacaacgagctgagcgaagcagaacgaact
gcctggctggttcaagagctgaaaacccgtcggccgctggtaccagcgcgcatgccgttc
tcagaatcgacccgcgagatcattgaaaccctgcggatggtcaagcagctacaggaagaa
tttggggaggcggcttgccaaacctacatcatcagcatgagccgcgagctgagcgacctg
ctggaagtgctgctgctggccaaggaggttggtctctacgacccagtcaccggcaagagt
tcgcttcaggtgattccgctgtttgaaactgtggaggacttacaaaatgccccgcgggtg
atgacggcgctgtttgagctgcccttctacacccagctcaaccccacccagtctgaaccg
ctgcaggaagtgatgctggggtattccgacagtaacaaggactcgggcttcctcagcagt
aactgggagatccacaaggcccagaaagccctagggacggtagcccgcgaccaccgcgtc
aagctgcggatcttccacggccgcgggggctccgtcggtcgaggtggtggccctgcctac
gaggcgatcttggcccagccgggtcgcaccacagatggccgaatcaagattacggaacag
ggcgaggtcttggcttcgaaatacgccctgcccgaactggcgctctataaccttgagacg
atcacgacggcggtgattcagtccagcctgctgggtagcggctttgatgacattgagccg
tggaaccaaattatggaagagttggcggcgcgatcgcggcgacattaccgcgctttggtg
tacgagcagcccgacctggttgacttcttcaatcaggtaacgccgattgaggagatcagc
aaactgcaaatcagctcgcgaccggctcgacgcaaaaccggcaagcgcgatctgggcagt
ctacgtgccatcccctgggtctttagctggacgcagagtcgttttctgctgccctcttgg
tatggcgtcggcacagcacttcaggagtttttgcaggagcgcccggagcagaacctcaac
ctgctgcgctacttctacgagaagtggccgttcttccgcatggtgatctcgaaggtcgag
atgaccctagcgaaggtcgatttgcagattgctcatcactacgtgcatgagctggccaat
cctgaggatcaagagcggtttgaacgagtgttcagccaaatcgctgcagagtttcagctg
acttgtcatctcgtgttgacgattaccaaccacggtcgcttgctggatggcgaccccgaa
ctgcagcgatcggtgcagctgcgcaacggtacgatcgtgcccctcggcttcttgcaagtc
gccctgcttaaacgcctgcggcagtatcgccagcaaacggaaacgacgggattgatgcga
tcgcgctatagcaaaggggaactgctgcgcggagcattgctgacgatcaacggcattgcg
gctggcatgcgcaatacaggttga

DBGET integrated database retrieval system