KEGG   Synechococcus sp. UTEX 2973: M744_05060Help
Entry
M744_05060        CDS       T03581                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
syu  Synechococcus sp. UTEX 2973
Pathway
syu00620  Pyruvate metabolism
syu00680  Methane metabolism
syu00710  Carbon fixation in photosynthetic organisms
syu01100  Metabolic pathways
syu01120  Microbial metabolism in diverse environments
syu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    M744_05060
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    M744_05060
   00680 Methane metabolism
    M744_05060
Enzymes [BR:syu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     M744_05060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AJD57249
LinkDB All DBs
Position
942528..945551
Genome map
AA seq 1007 aa AA seqDB search
MSAALQSSDDAFRTVSSPLATDLDLSSPLEFFLRHRLTVVEELWEVVLRQECGQELVDIL
TQLRDLTSPEGQAPEVGGEALVQVIETLELSDAIRAARAFALYFQLINIVEQHYEQTQYQ
LAYERSRLEPLPGPDESPEGLHTIEIPQHQLDPFAAVIPLNQDPATFQTLFPRLRQLNVP
PQMIQELTDRLDIRLVFTAHPTEIVRHTIRDKQRRIAYLLRQLDELETGKNRGFRELEAQ
NIRQQLTEEIRLWWRTDELHQFKPTVLDEVDYALHYFQEVLFEAIPLLYQRFRLALQGTF
PDLQPPRYNFCQFGSWVGSDRDGNPSVTSAVTWQTACYQRSLVLDRYITAVEHLRNVLSL
SMHWSEVLPELLSSLEQESMLFPETYEQLAVRYRQEPYRLKLSYILERLHNTRDRNTRLQ
QQQEKDPTTPLPEYRDGTLYQAGTAFLEDLKLIQHNLKQTGLSCYELEKLICQVEIFGFN
LVHLDIRQESSRHSDAINEICEYLQILPQPYNELSEAERTAWLVQELKTRRPLVPARMPF
SESTREIIETLRMVKQLQEEFGEAACQTYIISMSRELSDLLEVLLLAKEVGLYDPVTGKS
SLQVIPLFETVEDLQNAPRVMTALFELPFYTQLNPTQSEPLQEVMLGYSDSNKDSGFLSS
NWEIHKAQKALGTVARDHRVKLRIFHGRGGSVGRGGGPAYEAILAQPGRTTDGRIKITEQ
GEVLASKYALPELALYNLETITTAVIQSSLLGSGFDDIEPWNQIMEELAARSRRHYRALV
YEQPDLVDFFNQVTPIEEISKLQISSRPARRKTGKRDLGSLRAIPWVFSWTQSRFLLPSW
YGVGTALQEFLQERPEQNLNLLRYFYEKWPFFRMVISKVEMTLAKVDLQIAHHYVHELAN
PEDQERFERVFSQIAAEFQLTCHLVLTITNHGRLLDGDPELQRSVQLRNGTIVPLGFLQV
ALLKRLRQYRQQTETTGLMRSRYSKGELLRGALLTINGIAAGMRNTG
NT seq 3024 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgctctccagtcatccgacgatgctttccgaaccgtttcgagtcccctcgcc
acggatttggatctgtcgtctccgctggagtttttccttcgccatcgcttgacggtggtt
gaagaactctgggaagtggttttgcgccaagagtgcggccaagagctggtcgatattctg
actcagctgcgtgacttgacctcgccggaaggccaagccccagaagtgggcggcgaagcc
ttggttcaggtgattgaaaccctagagttgagcgatgcgattcgggctgcccgtgccttt
gcgctctactttcagctgatcaatattgttgagcagcactacgagcaaactcaatatcaa
ctcgcctacgagcgatcgcggttggaacccttgccaggaccagatgaaagtccggaggga
ttgcacaccattgaaattcctcagcatcagctcgatccctttgctgcggtgattccgctc
aaccaagatccggcaaccttccaaacgctgttcccgcgcctgcgccagctcaatgtgccg
ccgcaaatgatccaagagctgaccgatcgcctcgatattcggctggttttcaccgctcac
ccgacggaaattgtccgccacacgattcgcgacaaacaacgccgaattgcctacctgctg
cggcaactggatgagctcgaaacaggcaaaaaccgaggctttcgagagcttgaagcgcag
aatattcgtcagcagctgaccgaggagattcggctctggtggcggacggatgagctccac
cagttcaagccaacggtgttggatgaggtggactacgcgctccactacttccaagaagtc
ctctttgaggccattcctctgctctatcagcgctttcggctcgcgctgcaggggactttc
cccgacctacaaccgccccgctacaacttctgccagttcggctcttgggtcggctccgat
cgcgatggcaatccttcagtgacctctgccgtcacttggcaaaccgcttgctatcagcgc
agtctcgtcctcgatcgctacatcacagcggttgaacatctccgcaatgtgctcagcctc
tcgatgcactggagcgaggtgctgccggagttgctcagctcgttggaacaggagagcatg
ctcttcccggagacctatgagcagctagcggtccgctatcgccaagagccctatcgcctc
aagctctcctatattctggagcgcctgcacaacacccgcgatcgcaatacccgcctccaa
cagcagcaagaaaaagatcccaccacgcccctgcccgaatatcgggatggcaccctctac
caggctggtacggcctttctcgaagatctcaagctgattcagcacaaccttaagcagacg
ggactgagctgttacgagctagagaagttgatctgccaggtcgagatctttggtttcaac
ctggtccatctcgacattcgccaagaaagctcgcgccattccgacgcgatcaacgaaatc
tgtgaatacctccaaattcttccccagccctacaacgagctgagcgaagcagaacgaact
gcctggctggttcaagagctgaaaacccgtcggccgctggtaccagcgcgcatgccgttc
tcagaatcgacccgcgagatcattgaaaccctgcggatggtcaagcagctacaggaagaa
tttggggaggcggcttgccaaacctacatcatcagcatgagccgcgagctgagcgacctg
ctggaagtgctgctgctggccaaggaggttggtctctacgacccagtcaccggcaagagt
tcgcttcaggtgattccgctgtttgaaactgtggaggacttacaaaatgccccgcgggtg
atgacggcgctgtttgagctgcccttctacacccagctcaaccccacccagtctgaaccg
ctgcaggaagtgatgctggggtattccgacagtaacaaggactcgggcttcctcagcagt
aactgggagatccacaaggcccagaaagccctagggacggtagcccgcgaccaccgcgtc
aagctgcggatcttccacggccgcgggggctccgtcggtcgaggtggtggccctgcctac
gaggcgatcttggcccagccgggtcgcaccacagatggccgaatcaagattacggaacag
ggcgaggtcttggcttcgaaatacgccctgcccgaactggcgctctataaccttgagacg
atcacgacggcggtgattcagtccagcctgctgggtagcggctttgatgacattgagccg
tggaaccaaattatggaagagttggcggcgcgatcgcggcgacattaccgcgctttggtg
tacgagcagcccgacctggttgacttcttcaatcaggtaacgccgattgaggagatcagc
aaactgcaaatcagctcgcgaccggctcgacgcaaaaccggcaagcgcgatctgggcagt
ctacgtgccatcccctgggtctttagctggacgcagagtcgttttctgctgccctcttgg
tatggcgtcggcacagcacttcaggagtttttgcaggagcgcccggagcagaacctcaac
ctgctgcgctacttctacgagaagtggccgttcttccgcatggtgatctcgaaggtcgag
atgaccctagcgaaggtcgatttgcagattgctcatcactacgtgcatgagctggccaat
cctgaggatcaagagcggtttgaacgagtgttcagccaaatcgctgcagagtttcagctg
acttgtcatctcgtgttgacgattaccaaccacggtcgcttgctggatggcgaccccgaa
ctgcagcgatcggtgcagctgcgcaacggtacgatcgtgcccctcggcttcttgcaagtc
gccctgcttaaacgcctgcggcagtatcgccagcaaacggaaacgacgggattgatgcga
tcgcgctatagcaaaggggaactgctgcgcggagcattgctgacgatcaacggcattgcg
gctggcatgcgcaatacaggttga

DBGET integrated database retrieval system