KEGG   Synechococcus sp. WH7803: SynWH7803_0454Help
Entry
SynWH7803_0454    CDS       T00524                                 

Gene name
ppc, pepC
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
syx  Synechococcus sp. WH7803
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SynWH7803_0454 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SynWH7803_0454 (ppc)
   00680 Methane metabolism
    SynWH7803_0454 (ppc)
Enzymes [BR:syx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SynWH7803_0454 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
complement(465305..468316)
Genome map
AA seq 1003 aa AA seqDB search
MIMTVSDPGGSSMSSSSAITPESEQAMAAVNDAPVGGQLLQQRLALVEDLWQTVLRSECP
AEQAERLLRMKQLSDPVLPEGNAVSSDALVSLIRDMDLSEAIAAARAFSLYFQLVNILEQ
RIEEDGYLESIVRSQDTAEQINPFTPPLATQTEPATFRELFERLRRLNVPPAQLETLLQE
LDIRLVFTAHPTEIVRHTVRHKQRRVASLLQQLEAQTESSTFEAGTIRLQLEEEIRLWWR
TDELHQFKPSVLDEVDYALHYFQQVLFDAMPQLRRRLSSALASSYPDVQLPPSSFCTFGS
WVGSDRDGNPSVTTDITWRTACYQRQLMLERYVSAVQGLRDQLSISMQWSQVSAPLLESL
EMDRLRFPEVYEERATRYRLEPYRLKLSFVLERLRLTQIRNQQLAEAGWRAPADGLLSSN
PEAPQSESLHYGSVAEFRSDLELIRTSLVSTDLTCEPLDTLLTQVHIFGFSLAGLDIRQE
STRHSDALDEVSRYLNPDQAYGDLNEQERVQWLLQELQTRRPLIPPSVSWSPTTEETVDV
FRTLHRLQDEFGSRICRTYVISMSHSVSDLLEVLLLSKEAGLVEPSAGHADLLVVPLFET
VEDLQRAPEVMEELFQTPLYRNLLPRVGSQGQPLQELMLGYSDSNKDSGFLSSNWEIHKA
QIALQDLAARNGVALRLFHGRGGSVGRGGGPAYQAILAQPSGTLQGRIKITEQGEVLASK
YSLPELALYNLETVSTAVVQNSLVTNQLDATPSWNDLMARLARCSRRHYRALVHDNPDLV
AFFEQVTPIEEISKLQISSRPARRKTGTRDLSSLRAIPWVFGWTQSRFLLPSWFGVGTAL
HEELVNDPDQMSLLRTLHQRWPFFRMLISKVEMTLSKVDLDLARHYVTSLGSADHRQAFD
GIYTTIAEEYSLTHRLVLEITGQERLLDADPALQLSVDLRNRTIVPLGFLQVALLRRLRD
QNRQPPMSESPSDGDGRTYSRSELLRGALLTINGIAAGMRNTG
NT seq 3012 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgacggtttctgatcccggcgggtcttcgatgtcctcctcctccgcaatcact
cctgagagcgagcaggccatggccgcggtcaacgacgcccctgtcggtggacaactcctg
cagcaacgactggccctggtcgaggacctctggcagaccgttctgcgcagtgagtgccca
gccgagcaggcggagcgcttgctgcgcatgaaacaactcagcgacccggtccttcccgag
ggaaacgccgtgagcagtgatgctttggtgtcgctgatcagggacatggacctgtcggaa
gcgatcgctgccgctcgggccttttccctctatttccaactggtgaacatcctcgagcag
cgcatcgaggaagacgggtatctggagagcatcgtccgttcccaggacacagcggaacag
atcaacccgttcacccctcccctggccacccagacagaacccgcaacctttcgggaactg
tttgaacgtctgcgccgactgaacgtcccccctgcccagctggagacgctgctccaggag
ctcgatatccgcctggtcttcaccgctcaccccaccgagatcgtccgtcacaccgtccgc
cacaaacagcgccgcgtggcaagccttctgcagcagctcgaagcccagactgaatccagc
acctttgaagcgggaacgatccgccttcaattggaggaggaaatcaggctgtggtggcgc
actgatgagctgcaccagttcaagccctcggtgttggatgaggtcgattacgccctgcac
tacttccagcaggtgctgttcgatgccatgccccagctgcgtcgccgcctctcctcggca
ctggccagcagctacccggatgtgcaactgccgccgtcgtccttttgcaccttcggatcc
tgggttggatccgatcgcgatggcaatccatcggtcacgaccgacatcacctggcgaaca
gcctgttatcagcgccagctgatgctggagcgttacgtgagcgcggttcaggggcttcgc
gaccagctgagcatttccatgcaatggagccaagtcagcgccccacttcttgaatccctg
gaaatggatcggttgagattcccggaggtgtacgaagagcgggccacccgctaccgcctt
gagccttaccgtctcaagctgagttttgtgcttgagcggctgcgcctcacgcagatccgc
aaccagcagcttgcggaagccggttggcgtgctccagcggatggactgctgagctccaac
cccgaggcaccgcagagtgaatcgcttcactacggatctgtggccgagttccgcagtgac
cttgaactgattcgcacgagtttggtcagtacagacctcacctgcgaacccctcgacacg
ctgctcacccaggtgcacattttcgggttcagccttgccggtctggacattcgccaggag
agcacccgccacagcgatgctctcgatgaagtgagtcgctatctcaaccccgaccaggcc
tacggggatctgaacgaacaggaacgcgtgcagtggctgcttcaggagctgcagacccgc
cgccccctgatcccaccctcggtgagctggtcaccaacaacggaagaaaccgttgatgtg
ttccgaaccctgcatcgcctgcaggacgaattcggcagtcgaatttgccgaacgtatgtg
atctccatgagccacagcgtttcggatctgctcgaggtgctgctcctttccaaggaggca
gggcttgtggaaccgtctgcaggccatgccgacctgctggtggttccgctcttcgaaacc
gtggaggatctccagagagccccagaggtgatggaagagttgttccagacaccgctttat
cgcaaccttcttcccagggttggcagccagggccaacccttgcaggagctgatgctcggg
tattccgatagcaacaaggattcgggctttctctccagcaactgggagattcacaaagca
cagattgcccttcaggaccttgcagcgaggaacggcgtggccctgcggctgttccacgga
cgtggtggttcagtgggccggggagggggacctgcctaccaggcgatcctggcgcaaccc
agcggcacgctccagggacgcatcaaaatcacggagcaaggggaagttctcgcctccaag
tacagcctgcctgaactcgctctctacaacctcgaaacagtgagcaccgccgttgtgcag
aacagcctggtcaccaaccaactggatgccactcccagctggaacgatctaatggcgcga
ctggcgcgttgctcaagacgccactaccgcgcgttggtgcacgacaaccccgatctggtc
gccttcttcgagcaggtgacgccaatcgaggagatcagcaagctgcagatctccagccgg
cccgcccggcgtaagaccggaacgcgggatctctccagcctgcgggccattccctgggtg
tttggctggacccagagccgctttctcctccccagctggtttggcgtcggaacagctctg
catgaagagcttgtgaacgaccccgatcagatgtcgttgctgaggaccctccaccagcgc
tggcctttcttcaggatgctgatttccaaagtggagatgaccctctccaaggtggatctc
gatctggcccgtcactacgtgaccagcctggggagtgccgatcatcgtcaagcgttcgac
ggcatctacacgaccatcgccgaggaatacagcctcacccaccggctggtactggagatc
acagggcaagaacgactgctggatgccgatccagccctccagctctccgtggatctgcgc
aaccgcaccatcgtgcccttgggatttctgcaggtcgccctgctgcgccgattacgggac
cagaatcgtcaaccgcccatgagcgaatctcccagcgacggcgacggccgcacgtacagc
cgaagcgaacttctgcgtggtgcccttctcacgatcaatggcattgccgcaggcatgcgc
aacaccgggtga

DBGET integrated database retrieval system