KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2043Help
Entry
SYNGTS_2043       CDS       T02098                                 

Gene name
odhB
Definition
(GenBank) dihydrolipoamide acetyltransferase component(E2) of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
syy00010  Glycolysis / Gluconeogenesis
syy00020  Citrate cycle (TCA cycle)
syy00620  Pyruvate metabolism
syy01100  Metabolic pathways
syy01110  Biosynthesis of secondary metabolites
syy01120  Microbial metabolism in diverse environments
syy01130  Biosynthesis of antibiotics
syy01200  Carbon metabolism
Module
syy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNGTS_2043 (odhB)
   00020 Citrate cycle (TCA cycle)
    SYNGTS_2043 (odhB)
   00620 Pyruvate metabolism
    SYNGTS_2043 (odhB)
Enzymes [BR:syy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SYNGTS_2043 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase PASTA
Motif
Other DBs
NCBI-ProteinID: BAK50791
LinkDB All DBs
Position
complement(2250473..2251774)
Genome map
AA seq 433 aa AA seqDB search
MIYDIFMPALSSTMTEGKIVSWTKSPGDKVEKGETVLVVESDKADMDVESFNEGYLAAIL
VPAGEEAPVGATLGLVVETEAEIAEAQAKAGSGGGSSAAPTATPAPQQPEPVAIASATAI
ETTPAPSSNGNGKGSGRIIASPRAKKLAKELKVDLATIAGTGPHGRIVAADIESAAGKPV
TASIAAPSAPAPKTSPAPTPRVTSTPSVPVGQTVPLTTFQKALVQNMVAAMAAPTFRVGY
TITTDGLDQLYKQIKGKGVTMTALLAKAVALALKKHPIVNASYTDQGIIYHKDVNIALAV
AMPDGGLITPVLQNADQVDIYSLSRRWKELVERARAKQLQPEEYSTGTFTISNLGMFGVD
RFDAILPPGQGGILAVGASRPQVVANEEGLIGTKRQMAVNVTCDHRVIYGAHAAAFLKDL
AVIIEENAQSLTM
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgacattttcatgcccgccctgagttccaccatgaccgaggggaaaattgtt
tcttggactaagtcccccggcgacaaagtggaaaaaggtgaaactgtcttggtggtggaa
tcggacaaagcagatatggacgtggagtcctttaacgaaggttacctagccgccattcta
gttccagcaggggaagaagctcccgtgggggcaacccttggcctagtggtggaaacggaa
gcggaaattgccgaagcccaagctaaagctggctctggtggtggttctagtgcggctccg
actgcaaccccagccccccaacaacctgaaccagtggcgatcgccagtgcaactgccata
gagacaactccggcccctagcagtaacggcaatggcaaaggcagtgggcgaattattgct
tccccccgggcgaaaaaactagccaaagagttaaaagttgatttagctaccattgctggc
actggcccccacggcagaattgtggccgcagatattgaaagtgccgctggtaaacccgtc
actgcttccatcgctgcccccagtgccccagctcctaaaacatcccctgcccctactcca
agggtaacctctacccccagtgttcccgtcggccagacagtacccctgaccactttccaa
aaagctttggtgcaaaatatggtggccgccatggccgctcctacattccgagtgggctac
accatcaccaccgatggactggatcaactttataaacaaatcaaaggcaaaggggtgact
atgacggccctgttggctaaagctgtggctctggccttgaaaaaacatcccattgtcaac
gccagctacactgaccaaggcatcatctaccacaaggatgtcaacattgctctggccgta
gccatgcccgatggcggtttaattactccggtgttgcaaaatgcagaccaagtagatatc
tactccctctcccgccgatggaaagaattggtggaacgggcccgggctaagcagttacag
cctgaagaatacagcactggcactttcactatttctaacctgggtatgtttggggtagac
cgatttgatgccattctaccgccgggtcaagggggaattttagcggtgggtgcttcccgt
ccccaagtagtggccaatgaggaaggtttgattggtaccaaacgacaaatggcggttaat
gtaacctgtgaccatcgggtaatttatggggcccatgccgccgctttcctgaaggatttg
gctgtcattattgaagagaatgcccagtctttgactatgtaa

DBGET integrated database retrieval system