KEGG   Thermoplasma acidophilum: Ta0013Help
Entry
Ta0013            CDS       T00037                                 

Definition
(GenBank) probable Fe-superoxide dismutase (sod)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tac  Thermoplasma acidophilum
Brite
Enzymes [BR:tac01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Ta0013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CAC11162
UniProt: Q9HM56
LinkDB All DBs
Position
12098..12715
Genome map
AA seq 205 aa AA seqDB search
MAETWEIKEKLKPRGLEGISDVQIDNHFDVHYKGYVNKLNEIWSRLPDVDRSKANQNYSE
FRALKLEETFNYGGSLLHELYFEGLTPKHSEVPKEFKDAVAKDFGSYEKWLEDFKATGTA
FRGWAILVFDLNYGKLRNIGSDAHNVGLIWNSIAILTMDVYEHAYYVDYGAKRAPYLDAF
LKNVNWPVVLDRLNRAKKAYEAFKS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcagagacatgggaaataaaggaaaaactgaaaccaaggggtctagaaggaatatca
gacgtgcagatagataaccacttcgatgtacactacaaggggtatgtcaacaaactcaat
gagatatggagcaggctgcccgatgttgacaggagcaaggcaaatcagaattacagcgaa
tttcgtgctctgaagcttgaggaaacattcaactatggaggttctctgctacatgaacta
tactttgagggcctgaccccgaaacattccgaggttccgaaggaattcaaggatgcagtt
gcaaaggatttcggttcatatgagaagtggctcgaggattttaaggcaaccggaaccgca
ttcaggggatgggcaatacttgtcttcgatctaaactatgggaagcttagaaacataggg
tccgatgcgcacaacgttggactgatatggaactcgatagccatactgaccatggacgtc
tacgaacatgcgtactacgttgattatggagcaaagagagcaccttaccttgacgcattc
ctcaagaatgtaaactggccggttgttctcgacaggctcaacagggcaaagaaggcatac
gaagctttcaaatcctga

DBGET integrated database retrieval system