Trichoplax adhaerens (placozoan): TRIADDRAFT_63164 Help Entry TRIADDRAFT_63164  CDS       T01069                                  Name (RefSeq) expressed hypothetical protein   KO K14739   metallothionein 1/2 Organism tad  Trichoplax adhaerens (placozoan) Brite KEGG Orthology (KO) [BR:tad00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tad03019]     TRIADDRAFT_63164    03029 Mitochondrial biogenesis [BR:tad03029]     TRIADDRAFT_63164 Messenger RNA biogenesis [BR:tad03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      TRIADDRAFT_63164 Mitochondrial biogenesis [BR:tad03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     TRIADDRAFT_63164 BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  6749670 NCBI-ProteinID:  XP_002107650 JGI:  63164 UniProt:  B3RIU4 LinkDB All DBs AA seq 65 aa AA seqDB search MDPPCNCAETGDCQCPSNCACTNCKCAPNCRLCGGKTCKCAENISSCVCTTCICTDCKCP KGCKN NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atggatcctccttgtaattgtgctgaaactggtgactgccaatgtccttctaactgtgcc tgcaccaattgtaaatgcgcacctaactgcagactctgtggtgggaaaacatgcaaatgc gctgaaaatatcagtagctgcgtctgcacaacttgcatatgtactgattgcaagtgtcct aaaggatgcaagaactaa

DBGET integrated database retrieval system