KEGG   Tepidanaerobacter acetatoxydans Re1: TepiRe1_0770Help
Entry
TepiRe1_0770      CDS       T02434                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tae  Tepidanaerobacter acetatoxydans Re1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TepiRe1_0770 (pfkA)
   00030 Pentose phosphate pathway
    TepiRe1_0770 (pfkA)
   00051 Fructose and mannose metabolism
    TepiRe1_0770 (pfkA)
   00052 Galactose metabolism
    TepiRe1_0770 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    TepiRe1_0770 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TepiRe1_0770 (pfkA)
Enzymes [BR:tae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TepiRe1_0770 (pfkA)
Protein phosphatases and associated proteins [BR:tae01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TepiRe1_0770 (pfkA)
Messenger RNA biogenesis [BR:tae03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TepiRe1_0770 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
772194..773153
Genome map
AA seq 319 aa AA seqDB search
MNRIGVLTSGGDAPGMNAAVRAIVRKAIHYGIEIYGVHRGFMGLINSDFVKLDISSVGDI
IHRGGTTLLTARCDEFKTEEGQRKALKNLEAFGIEGIIVIGGDGSLRGANALSKLGIPTI
GIPATIDNDIAFTDNCIGFDTAANTVVDALNKVRDTATSHERTFIIEVMGRRAGHLALYT
GLASGAETILVPEIPFDLNAVCDKIEKGYIRGKLHSIIVVAEGAANSMEVGKVIQEKTGL
ETRVIILGHLQRGGNPSAYDRILASRFGGKAVDLIIQNTKDKMLGLINGELVITDIEKVL
SATKPLDMELYQLSDVLSF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaattggagtacttacaagcggcggagatgcacccggcatgaatgctgcagtc
agagcgatagttaggaaagctatacattatggcattgaaatctatggtgtacatagaggc
tttatgggactaataaactcggactttgtaaaattggatataagttcggtaggtgatatt
atacatcgcggaggaaccactctacttactgccagatgtgatgagtttaagactgaagaa
gggcaaaggaaagcattaaaaaatcttgaagcttttggtattgagggaatcattgtaata
ggaggagatggctctcttagaggcgccaatgctttgtcaaaacttggtatccctacaatc
gggattcctgcaacgattgacaatgacatagcatttacagataattgtattggttttgat
actgctgcaaatacagtggttgatgcactaaacaaggttagagacactgcaacatcacat
gagcgaacttttattatagaagttatgggcagaagagcaggtcatctggctttatacacc
ggccttgccagcggggctgaaactattttggtaccggaaattccattcgatttaaatgcc
gtatgtgataaaattgaaaaaggctatatcagaggcaaactgcacagtattatcgtagtt
gccgaaggggcggccaacagcatggaagtaggaaaagttatccaggaaaaaaccggtctt
gaaacaagagttatcattttaggtcatttgcaaagaggtggcaatccttcggcatatgat
cgaatattggccagccgttttggaggaaaagctgttgatttaataatacaaaacacaaag
gataaaatgctaggtcttatcaatggggaactggttatcactgatatagaaaaagtgctt
agtgctactaaacccttggatatggaattatatcaattgtcagatgtattatcattttaa

DBGET integrated database retrieval system