Thermosipho africanus: THA_1384 Help Entry THA_1384          CDS       T00797                                  Name (GenBank) conserved hypothetical protein   KO K03676   glutaredoxin 3 Organism taf  Thermosipho africanus Brite KEGG Orthology (KO) [BR:taf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:taf03110]     THA_1384 Chaperones and folding catalysts [BR:taf03110]  Protein folding catalysts   Protein disulfide isomerase    THA_1384 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Thioredoxin_2 Glrx-like GST_N_2 Thioredoxin_4 Thioredoxin_3 ArsC DUF6033 AhpC-TSA Redoxin Thioredoxin Motif Other DBs NCBI-ProteinID:  ACJ75829 UniProt:  B7ICV2 LinkDB All DBs Position complement(1405438..1405680) Genome browser AA seq 80 aa AA seqDB search MQHVKIVVYTTPTCPYCKKAKNYFKQLGLKFKEYDVSKDQKAAERMYKKSGQLGVPVIEI GNQIVVGFDKAKIDRLLGIN NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgcaacacgtaaagatagttgtttacacaactccaacttgcccttattgtaaaaaagca aaaaattactttaaacaacttggcttaaaattcaaagaatacgatgtatcaaaagatcaa aaagcggcagaaagaatgtataaaaagagtggacaattgggtgtaccggtcattgaaatc gggaatcagatagtagtcggatttgacaaagctaaaattgataggttactaggtataaat tga

DBGET integrated database retrieval system