KEGG   Tolumonas auensis: Tola_0232Help
Entry
Tola_0232         CDS       T00904                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tau  Tolumonas auensis
Pathway
tau00473  D-Alanine metabolism
tau00550  Peptidoglycan biosynthesis
tau01100  Metabolic pathways
tau01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Tola_0232
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tola_0232
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Tola_0232
Enzymes [BR:tau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Tola_0232
Peptidoglycan biosynthesis and degradation proteins [BR:tau01011]
 Precursor biosynthesis
  Amino acid ligase
   Tola_0232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ACQ91862
JGI: Tola_0232
UniProt: C4L8J2
LinkDB All DBs
Position
complement(262466..263458)
Genome map
AA seq 330 aa AA seqDB search
MKHLHVLLLCGGGGSEHEISLLSANYLESQLKELAEVSVTRVELFPDHWQTNDGRSCHLG
MDRQLHFANEAKPVDFVVPCIHGFPGETGDIQSMLELIGLPYLGCGSEGSKLCFNKVSTK
LWLSALDIPNTPFLFLSDNNEAAHAQAHTAFRNWGAVFVKAASQGSSVGCYKVTDAAKLS
EAVNAAFGYSDQVLVEKAVRPRELEVAVYRYNDQLVATRPGEIATPSDSFYSYEEKYSSG
SNSTTYLEAPGLSDAQISTIREYALKAFTQLGLKDLSRIDFFLTEDNEILLNEINTFPGM
TPISMFPKLLEHHGDNFKQFLEGIIRSTVK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaccttcacgtactgctgctgtgcggcggtggcggcagtgagcatgagatttct
ctgctgagtgctaactatctggaaagccagctgaaagagctggccgaagtcagcgtgacc
cgcgttgaactattcccggatcactggcagaccaacgatggccgttcctgccatctgggt
atggatcgtcagctgcatttcgccaacgaagccaaacccgttgatttcgtggtgccttgt
attcacggcttccctggtgaaaccggtgatattcagtcgatgctggaattgatcggcctg
ccttatctgggctgtggctccgaaggcagcaaactttgctttaacaaagtcagtaccaag
ctgtggttatccgcgctggatattccgaacacgccgtttctgttcctgtctgataacaat
gaagccgcacatgcgcaggcacataccgcattccgtaactggggcgccgtatttgttaag
gccgccagtcagggctcttccgtgggttgctataaagtaaccgatgccgccaaactgtct
gaagcggtgaatgccgcctttggttattccgatcaggtgctggttgaaaaagccgttcgc
ccacgcgagctggaagtcgccgtttaccgttataacgaccagctggtcgcaacccgtccg
ggtgaaatcgccacaccaagcgacagcttctacagctatgaagaaaaatacagttcaggc
agtaattcaacgacttatctggaagcgccgggtctgagcgatgcacagatcagcaccatt
cgtgaatatgcactgaaagccttcactcagctgggcttaaaagatctgtcgcgtatcgat
ttcttcctgaccgaagataacgagatcctgctgaacgaaatcaacaccttcccggggatg
accccgatctccatgttcccgaaactgctggaacatcatggtgataacttcaaacaattc
ctggaaggcattattcgcagcacagtgaaataa

DBGET integrated database retrieval system