KEGG   Thiobacillus denitrificans: Tbd_0122Help
Entry
Tbd_0122          CDS       T00275                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tbd  Thiobacillus denitrificans
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tbd00001]
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Tbd_0122
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tbd_0122
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Tbd_0122
Enzymes [BR:tbd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Tbd_0122
Peptidoglycan biosynthesis and degradation proteins [BR:tbd01011]
 Precursor biosynthesis
  Amino acid ligase
   Tbd_0122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
130908..131840
Genome map
AA seq 310 aa AA seqDB search
MSETVSAKKFGKVAVMLGGTSAERPVSLNSGNAVLAALTRQGIDAHAFDPATRSLGDLMS
GEFDRVFIALHGRYGEDGCMQGALELLGIPYTGSGVMASAVGMDKWRTKLLWRAAGLPTA
DWAMLDATSDFAATEARLGLPIFVKPAREGSSIGMSKVTEAGTLQAAYEKAAEHDALVLA
EKFIDGAEFTVGIVGDSALPLIRLQPAAEKAFYDFEAKYLRDDTQYHCPAGLPDAQEMSL
RKLALDAFRLLGGRGWGRVDLMTDRLGNPYLLEVNTSPGMTDHSLVPMAARVAGIDFDAL
CVTILEQTLG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaaacggtttcagcgaaaaaattcggcaaggtcgccgtgatgctcggcggcacc
tcggccgagcggccggtatccctgaacagcggcaatgcggtgctcgcggcgttgacgcgc
cagggcatcgacgcgcacgcgttcgacccggcgacacgcagcctcggcgacctcatgagc
ggcgagttcgatcgtgtgttcatcgcgctgcacgggcgctacggcgaagacggctgcatg
cagggcgccctcgaactgctcggcattccctataccggcagcggggtgatggcctcggcg
gtcggcatggacaagtggcgcaccaagctgctgtggcgtgcggccggcctgccgaccgcg
gactgggccatgctcgacgcgacgagcgatttcgccgcgaccgaggccaggctcgggctg
ccgatcttcgtgaagccggcgcgcgagggttcgagcatcggcatgagcaaggtgaccgag
gccggaacgttgcaggccgcctacgagaaggccgccgagcacgacgcgctcgtgctcgcg
gaaaaattcatcgacggcgccgaattcacggtcggcatcgtcggcgacagcgcgctgccg
ctgatccgtctgcaaccggcagccgaaaaggcgttttacgatttcgaggcgaaatacctg
cgcgacgacacccagtaccactgcccggccggcctccccgacgcccaggagatgagcctg
cgcaaactcgcgctcgacgccttccgcctgctcggcggccgcggctggggccgtgtcgac
ctcatgaccgatcgcctcggcaatccctatctgctggaagtgaacacctcgcccggcatg
accgaccacagcctcgttccgatggccgcgcgcgtcgccggcatcgacttcgacgcgctt
tgcgtcacgatcctggagcagacgctcggatga

DBGET integrated database retrieval system