KEGG   Tribolium castaneum (red flour beetle): 660658Help
Entry
660658            CDS       T01046                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-79 specific
  KO
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    660658
Enzymes [BR:tca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     660658
Chromosome [BR:tca03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     660658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
LGX
AA seq 1329 aa AA seqDB search
MCALELKLHSPAGAEPVLYTWPLTSGRGNDKHDGALEIVETIRWVCEDLPELKLPLENNI
LCDYDTKDYESMKNLCDRFNRAIDSVVALEKGTSLIAQRLNKYPSRGLLRHILQQTYNAA
VTDPEKLNQYEPFSPEVYGETSYDLVCQMIDQIDVTSDDVFIDLGSGVGQVVLQMAAATP
CKVCFGIERAEVPSRYAEAMNKYFRTWMSWYGKRYGEYKLIRSDFLTEEHREKINQATIV
FVNNFAFGPAVDHQLKERFADLKDGARIVSSKSFCPLNFRITDRNLSDIGTIMHVSEMTP
MKGSVSWTGKPVSYYLHRIDRTKLERYFQRMKKPQLKNGDDNDNSRSAREKAKRDLSKQL
GSSSDSDYDDQDSNYGPTTRKAWSDYCSTKGKSSQSEEEGNNKNGKRQPKKLRRKIQRGK
NQANGEKAQKTGPKSRRGRVKKGGKPKKTIKINGLDLLHNETLLSTSPQAIGKKLPPAPG
CVDQQLTALSTELVHNELDIPQAPASTPYGLQILLDMFRAQYMQMLNQMKQPTYKTSVEN
HIKQEKERNKKLQNRAAQLEKQIKVLIDDSVALLKARMSELGINATSPVDLLAKAKEIVC
RHKELQAKASKLQGQVASLEQEQNNLVIQRQQEIVEKYNGRDTCHDLSPIATQEYILREI
SSTLAHRKKLHNQVSRLEGELLSLEKANEERKQAQALATRQQQTPSTKSSRKSREYRARS
QDWPDVPDIAKIEEQNPEILAQKILETGRKIEASKMSANCRKINLVRNNMPAPLPVPKRQ
KTSYSLPPTQSSATRAQEPPRLADFEDRLKSIITSALNEDQQNRNRAQSAYQQQQNYVNF
QNDKHKFAKYNRCETVVKQNEERSFAQQEGLAGMMESYRTEVPKVSPHVARQVAPEQPDY
TQVSPAKLALRRHLSQEKLAAQHHSFSSSDGIVATRTIGDLMSGEIERTLEISNQSIINA
AVDMSDIQGTTTLTSRSVVNVNLPPRPERVKVNNETKKAEPMRQVYSPISRPSSTEGLEG
LAYTPLPRADIRPYHESYFTDVKPPIEGEIRGNFVAEGLAASLQARVLSGPQIKEEVDVY
DRRSCVQPNVLYQDHNGSTIKSEGVSDCQYKRESPIIQGPIRNSLKRRLVDEQEPARVRK
CNEEDADVEEEGEESKWQDRISSGFDRLVAFASTELDKRRRSTEGSDSCNTSPDSGIGHG
DLPPSSLTVSTPAKQALKLNPNSKPTLFKMPNKIYLESPPLIGESGNDESGPPRTPSPSS
LISVPLNYSPEPPNEKSQPRLNPALLKYQREDKKVKPDQHYKKKFYYREQWRDDSWQNRD
HDRYCSWKN
NT seq 3990 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgcgctggaattgaaactgcattctccggcgggggcagaaccagtattatacact
tggccgttaacctcaggacgaggaaacgacaaacatgatggtgcccttgagatcgtcgaa
accatcagatgggtctgtgaagatctgccggagcttaaactgccgttggaaaacaacatt
ctctgtgattatgatacgaaagattacgagagtatgaaaaatctctgcgatcggttcaat
cgggccattgacagcgttgttgctttggagaaaggaacgtcgctgatagcccaaaggctg
aacaagtacccgtccagagggctcctccgccacatcctccagcaaacgtacaacgctgcc
gtcaccgaccccgaaaaactgaaccaatatgaaccgttctcccctgaagtgtacggcgaa
acatcctacgatctagtctgccaaatgatcgatcaaatcgacgtgacatccgacgacgtg
ttcatcgacttgggctcaggagtgggtcaagtggttctccaaatggctgcggcgacgccg
tgcaaagtgtgcttcggcatagaacgggccgaagttccaagcagatacgccgaagccatg
aacaagtatttccggacgtggatgtcctggtacgggaagcgatacggagagtacaaatta
ataaggagcgattttttgacggaggaacaccgcgagaaaatcaaccaagcaacgatcgtt
tttgttaacaatttcgcgttcggaccggctgttgatcaccagctgaaagagcggttcgcc
gatttgaaggacggagctaggatcgtttcgtcgaagagtttttgtccgctgaattttcgg
atcaccgatcggaatttaagcgacatcgggacgataatgcacgtttcggagatgacgcca
atgaagggatcggtgtcctggactgggaaaccagtctcttattacttgcacaggattgat
cggacgaagctggaacggtatttccaaaggatgaagaagccacagctcaaaaacggtgac
gataatgacaattcacgtagtgcgcgtgaaaaggctaagagagatctttctaaacagttg
gggtcgtcatctgattccgactatgacgaccaagacagtaattatggacctacgacacgc
aaagcttggtccgattattgttccactaagggtaaaagtagtcagtcggaagaggagggt
aacaacaagaatggaaagcgacagccgaagaaattacggagaaaaatacaacgtgggaaa
aatcaagccaatggtgaaaaggcacaaaagacgggaccgaaatctcgcagaggaagagtg
aagaaaggtgggaaaccaaagaagacgatcaaaatcaacggcttggatctgctacacaac
gaaacacttctgagtacatccccgcaagcgataggtaaaaagcttccaccagcacctggt
tgtgtcgatcagcaattaacagcattaagtactgaactcgttcacaatgaattagacata
cctcaagccccagcaagtacaccgtacggtctccagattcttttagacatgtttagagct
caatatatgcaaatgttgaatcaaatgaaacaaccgacttacaaaaccagcgtcgagaat
catatcaaacaagagaaagaaagaaataagaaactgcaaaaccgtgccgcccaactagaa
aagcaaataaaggtgttaatcgatgacagtgtcgcactcctgaaggcccgtatgagcgaa
ctgggaataaacgcaacatcaccggtcgatctcctagcaaaagccaaggaaatcgtgtgc
cgccataaagaactccaagcgaaagcaagcaaattgcaaggccaagtcgccagtttggag
caagaacagaacaatctggtcatccaacgacaacaagaaatcgtcgaaaagtacaacgga
cgcgacacttgccacgacttatcgccgatcgcgacccaagaatacattttacgcgaaata
tcctcaaccctcgcccaccgcaaaaaactccacaatcaagtgtcgcgtctcgaaggcgag
ctcctctccctagagaaagccaacgaggagcgcaaacaagcacaagctctagccacgcgc
cagcaacaaacacccagcacgaaatcgtcgcgaaaatcccgcgaataccgcgccaggtcc
caagactggcccgacgtgcctgacatcgccaaaatcgaagaacaaaaccccgaaatcctc
gcccagaaaatcctcgaaacggggcgcaaaatcgaagccagtaaaatgtcagcgaactgc
cggaaaatcaacctcgtccgcaacaacatgccggcccccttaccggtgccaaagcgtcaa
aaaacgagctattcgctaccaccaacccagagcagcgcaactcgggcccaagaaccgcca
agactggccgacttcgaggaccggctcaaaagcatcatcacgtcggcactgaacgaagac
cagcaaaaccgcaaccgggcgcagtctgcctaccagcagcagcaaaactacgtcaatttc
cagaacgacaaacacaagtttgctaaatacaatcggtgcgaaaccgtggtcaaacagaac
gaggagcgcagtttcgcccaacaggaaggtctcgccggcatgatggagtcgtaccggacg
gaagtgccgaaagtctcgccgcatgtggcaagacaagtggcgccggaacagcccgactat
acccaagtgtctccggccaagctagcgctgagacgccacctgtcccaggagaagttggcc
gcacaacaccacagttttagctcgtcggacggcatcgtcgccacgcgaaccatcggcgat
ttaatgtccggcgagattgaacggacgttggagatctcaaaccagtcgatcatcaacgct
gccgtcgacatgagtgacatccaaggcacaacgacgctgacatcgagatccgtggtcaat
gtgaacctccccccgcggccggagcgcgtcaaagtcaacaacgagacgaagaaagcggag
ccgatgcgccaggtctacagcccgatatcgcggccgtcgtccaccgagggtctggaaggc
ttggcgtacacgccgcttccgcgcgccgatatccggccgtaccacgagtcgtactttacc
gacgtcaagccgccgattgagggcgaaatccgcggcaatttcgtggcggaaggcttggct
gccagcttgcaagcgcgtgtcttaagcggcccgcaaatcaaggaagaggtggacgtttac
gaccggagaagttgcgtgcaaccaaatgtgctataccaggaccataatggctcgactatc
aaaagcgagggcgtcagtgattgtcagtacaaacgggagtcgccgattatacaagggccg
attcgcaattcgctgaagcggcggctagtggacgagcaagagccggcacgggtccggaag
tgcaacgaagaagatgcagatgtcgaagaagagggcgaagaatcaaaatggcaggaccgt
attagttcaggtttcgatcgcttggttgctttcgcatccaccgagttagataaacggagg
cgatcgactgagggtagcgacagttgtaacacgtccccagattcgggaataggtcacggt
gatttaccaccgtcctctttaacagtgtccactccggcgaaacaggcgttgaaattaaac
ccaaactcgaaaccgactctttttaaaatgccgaacaaaatttatttagagagtcctccc
ctaataggggagagtggaaacgacgaatctggaccacctcgaaccccgtctccttcttcg
ctcatcagcgttcctctaaattacagcccggaaccaccaaatgagaaaagccagccacgt
ctgaatccggctttacttaagtaccaacgcgaggataaaaaagttaaaccggatcaacac
tacaagaagaaattttattacagagaacagtggagggatgattcttggcaaaatcgcgac
cacgaccggtattgctcgtggaaaaattga

DBGET integrated database retrieval system