KEGG   Theobroma cacao (cacao): 18599890Help
Entry
18599890          CDS       T02994                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
tcc  Theobroma cacao (cacao)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:tcc00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    18599890
Enzymes [BR:tcc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     18599890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
5
AA seq 152 aa AA seqDB search
MVKAVAVLSSSEGVSGTIFFTQEGDGPTTVTGNISGLEPGLHGFHVHALGDTTNGCMSTG
PHFNPAGKEHGAPEDENRHAGDLGNVTVGDDGCVSFSIIDKQIPLTGPLSIIGRAVVVHA
DPDDLGKGGHELSKTTGNAGGRVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgttgccgtgcttagtagcagtgaaggtgtcagtggaactattttcttc
actcaagagggagatggtccaactactgtgactgggaacatttctggtcttgagcctggg
ctccacggcttccatgtccatgcccttggggacacaacaaatggttgcatgtcaacagga
ccccattttaatcctgctggcaaagagcatggtgccccagaagatgagaatcgccatgct
ggtgatctaggaaatgttactgttggtgatgatggctgtgtgagtttctctattattgac
aaacagattcctctcactgggccactctcaattattggaagagctgttgttgtccatgca
gatcctgatgaccttggcaaggggggccatgagcttagcaaaaccactggaaatgctggt
ggcagagtagcttgcggtataattggtctgcaaggctga

DBGET integrated database retrieval system