KEGG   Thauera chlorobenzoica: Tchl_1339Help
Entry
Tchl_1339         CDS       T04612                                 

Definition
(GenBank) Long chain fatty acid--AMP ligase
Organism
tcl  Thauera chlorobenzoica
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1407777..1410596)
Genome map
AA seq 939 aa AA seqDB search
MSSSLPAPEQRKAPAPSADALLELIDALVRELQPGNRLPAGLDSALDRDLGLDSLARVEL
LARVERRFAVRLAAETLGTCETPRQLLGAVAQAACAPLPPPAAPGAPLPPPAPARGEPDA
AATLLQVLGWHAGRHPERVHVTFYDRDERIETLTYGELADAAEHTAGALFALGLHAGDRV
ALMLPSGLDFFRAFFGILSAGMVPVPIYPPARPSQLEDHLQRQAGILRNCEARALITFER
VRPLARMLAGLAPALAHVATPAGLAAAPALRPLPASADELALIQYTSGSTGEPKGVMLTH
ANLLSNIRAWGTVAALDSNDVCVSWLPLYHDMGLIGTWMGSLYYACPLVLMSPLDFLAHP
ERWLWAIHHHRGTVTAAPNFAFELCVKRLADADLDGLDLSCWRLAANGAEPVNPDTLQRF
AATFAPYGLPATTVTPVYGLAECAVGLCVSPPGRGAVIDRVERSALHLGGDAVRAAADDG
EALRFVCCGAPLPGHEVRIVDGAGHVLPERRVGHLEFRGPSATAGYYRNPAASAALFDDG
WLVTGDHAYLADGELYVTGRAKEVIIRAGRNLYPYDLEQAIGALPGVRKGCVAVFGAGTD
GGEERLIVIAETAVDDAGARHRLQRQIVAAALAEFDLAPDAVILAPPHTVLKTSSGKIRR
AALREAYLRGGLDTPPRPPWLQLLRLQRASARARLRRHLQAVPAVMRAAWMWAMFAALAP
LAVAAILLLPRLDQRWTAIHRLARLCQRLCGCPLRVEGLRHLPAAPCILVANHASYIDGL
VLVAALPQPVRFVAKAELAGNRVLGPLFARMDTCFVNRADSRQSVEDSRRLGALASAGAP
LLFFAEGTFTAQEGLRALRLGAFQSAIEQALAVVPVALAGTRRVLRDGSWRPQPGALAVT
VCPPLAPAGEDWHALLALRDATRTSILARCGETDAAAPR
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagttctcttcccgcccctgaacagcgcaaagcacccgccccttccgccgacgca
ctgctcgaactgatcgatgccctggtacgcgagttgcagccgggcaaccgcctgccggcc
gggctcgatagcgcgctcgaccgcgacctcggcctcgacagtctcgcccgcgtcgagttg
ctcgcccgcgtcgaacgccgcttcgccgtccgccttgccgccgaaaccctgggcacgtgc
gagacgccgcgccagctgctgggcgccgtcgcacaggcggcgtgcgcccccctgccaccg
cctgccgctcccggcgcgcccctgccgccgcccgcgcctgcgcgcggcgagcccgacgcc
gccgccaccttgctgcaggtcctcggatggcacgccgggcgccatcccgagcgcgtgcac
gtgaccttctacgaccgcgacgagcgcatcgagaccctcacttacggcgaactcgccgac
gccgccgaacacaccgcaggcgccctcttcgcgctcggcctgcacgccggcgaccgggtc
gccctgatgctgccctcggggctggattttttccgcgccttcttcggcatcctgagcgcg
ggcatggtgccggtgccgatctatccgccggcgcgcccgagccagctcgaggaccacctg
cagcgccaggccgggatcctgcgcaactgcgaggcgcgcgcattgatcaccttcgagcgc
gtgcgcccgctggcgcgcatgctcgccggcctggcgccggccctcgcccacgtcgcgacc
cccgccgggctggccgcggcgcccgcgctccgtccgctgccggcaagcgcggacgagctc
gccctgatccagtacacctccggctccaccggcgagccgaagggggtcatgctgacccac
gccaacctgctcagcaacatccgcgcctggggcacggtggcggccctggactcgaacgat
gtgtgcgtgagctggctgccgctgtaccacgacatgggcctgatcggcacctggatgggc
agcctctactacgcctgcccgctggtgctgatgtcaccgctcgatttcctcgcccatccc
gagcgctggctatgggcgatccaccaccaccgcggcacggtgaccgcggccccgaacttc
gccttcgagctgtgcgtcaagcgcctcgccgacgctgacctcgacggcctcgacctgtcg
tgctggcggctcgccgccaacggtgccgagccggtcaaccccgataccctgcagcgtttc
gccgccaccttcgccccctacggcctgccggcgaccaccgtcactccggtgtacggcctc
gccgaatgcgcggtcggtctgtgcgtgtcgccgcccggccgaggcgccgtcatcgaccgc
gtcgagcgcagcgcgctgcaccttggcggtgacgccgtgcgcgccgccgccgacgacggc
gaggcgctgcgctttgtctgctgcggagcgccgctgcccggtcacgaagtgcgcatcgtc
gatggcgccggccatgtcctccccgagcgcagggtgggccacctggagttccgcggcccg
tcggcgaccgccggctattaccgcaacccggcggcgagtgcggcgctgttcgacgacggc
tggctcgtcaccggcgaccacgcctaccttgccgacggcgaactctatgtcaccgggcgg
gccaaggaggtgatcatccgcgccgggcgcaacctctacccctacgacctcgagcaggcg
atcggtgcgctgcccggagtgcgcaagggctgtgtcgcggtgttcggggccggcaccgac
ggcggcgaagagcgcctgatcgtcatcgccgagaccgccgtcgacgatgccggcgcccgc
caccgcctgcagcggcagatcgtcgccgcggcgctggccgagttcgacctcgccccggac
gcggtgatcctcgccccgccgcacacggtgctgaaaacctcgagcggcaagatccgccgc
gcagcgctgcgcgaggcctacctccgcggcggtctcgacaccccgccccgcccgccgtgg
ctgcagctgctgcgcctgcagcgggccagcgcccgtgcgcggctgcgccgccacctgcag
gccgttcccgcggtcatgcgcgcggcctggatgtgggccatgttcgcggcgctggcgccg
ctggcggtggcggcgatcctgctgctaccgcggctcgaccagcggtggacggcgatccac
cgcctcgcccgcctgtgccagcgcctgtgcggctgcccgctgcgggtcgaaggcctgcgc
catcttcccgccgcgccctgcatcctcgtcgccaaccatgccagctacatcgacgggctg
gtgctcgtcgccgccctgccgcagccggtgcgcttcgtcgccaaggccgagctcgccggc
aaccgcgtgctcggtccgctgttcgcccgcatggacacctgcttcgtcaatcgcgccgac
tcccgccagagcgtggaagacagccgccgtctcggcgccctcgcaagcgccggcgcaccg
ctgctgttcttcgccgaaggcacgttcaccgcgcaggaagggctgcgcgcgctccgcctc
ggcgccttccagagcgccatcgaacaagccctggcggtggttccggtcgccctcgccggc
acccgccgggtcttgcgcgacggcagctggcggccgcagccgggcgcgctcgcggtcacc
gtctgcccaccgctggcgccggcgggcgaggactggcacgccctgctcgccttgcgcgat
gccacgcggacatcgatcctcgcccgctgcggcgaaaccgacgccgcggcgccgcgctga

DBGET integrated database retrieval system