KEGG   Thermodesulfobacterium commune: HL41_00320Help
Entry
HL41_00320        CDS       T03212                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tcm  Thermodesulfobacterium commune
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tcm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HL41_00320
  Energy metabolism
   00680 Methane metabolism
    HL41_00320
Enzymes [BR:tcm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     HL41_00320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(58126..59607)
Genome map
AA seq 493 aa AA seqDB search
MKVPRVMSTQHPDNVSMPFFAEHPDMSGEDEIQEAYYAFSHLGCDEQMWDSEGKEVDDFV
VKKLYSKYPNFFKRHLLGKDCFITLRIPNPTVEKDEAKILVEALESIPRSMDAARIFLKD
HPPPIFEVILPMTTSAKELNRVYYYYKNFIAGLQHQPIYPGDITVAEWVGEFLPESINVI
PLFENIESFFNIDRILEEYVKDKNLTYLRVFLARSDPALNYGLISAVLGVKIALKKLESF
ALKHDVEVYPILGVGTPVFRGNFSPYTVEKVLSEYSSVETFTVQSAFKYDFPVEDVISGI
KKVKTFIRHPISDIDFEFCQKIIQKISEEYKATIAPIAPAINELAKFVPKRRMRKLHIGL
FGYSRSLHGIVLPRVISFCAACYSIGLPPEIFGLNALTKEELHELKNYYHNLEFDFSKAL
QYFNPKCLDLMPEEVKNKIIKALNLLNILNLNYEPNEEHKEVTSTLLKNLKKGLSSQATS
LIVEAGYLRKFLG
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttccaagggtgatgtctacccaacatccagataacgtttccatgccttttttt
gcagagcatcctgacatgtcaggtgaagacgagatccaagaggcctattatgccttttct
catttaggttgcgatgaacagatgtgggacagtgaaggcaaagaggtagacgactttgtg
gttaaaaagctttatagtaagtatcctaatttttttaaaagacatcttttaggcaaggac
tgttttatcacccttagaatccctaaccccacggtagaaaaagatgaggctaaaatttta
gttgaggccttagaaagtatccctcggtctatggatgcagcccgtatcttcttaaaggat
catcctcctccgatttttgaggtaatactcccaatgaccacttcagccaaggaactcaac
cgggtttattattactacaaaaactttatcgctggtctccaacatcaacctatttaccca
ggagacatcacggtagctgagtgggtaggtgagtttctacctgaaagtatcaacgttatt
ccactttttgaaaacatcgaatccttttttaacatagatcgaatcttggaagagtatgtt
aaagacaaaaatctgacctatcttcgggtgtttttagctcgatctgacccggcgttaaac
tatgggcttataagtgctgttttaggggttaaaattgccttaaaaaaattagaaagtttt
gccttaaagcatgatgtagaggtttatcctatattaggggtaggaacccctgtttttaga
gggaacttttctccttacaccgtagaaaaggttctttctgagtattcttcggtagaaacc
tttaccgttcagtctgcctttaaatatgattttccggtagaggatgtaatttcagggatc
aaaaaagtaaaaacttttatcagacatcctatctcagacatagactttgaattttgtcaa
aaaataatccaaaagatttcagaagagtataaagctaccatcgccccgattgctcctgcg
ataaacgaattagccaaatttgtaccaaaaagaaggatgagaaaactccatataggcctt
tttggttactcaagaagccttcatgggatagtgctcccaagggttataagcttttgtgct
gcctgttattctataggtcttccccctgaaatctttgggttaaacgctttaaccaaagaa
gagttacatgaacttaaaaactattaccacaacttagagtttgatttttctaaagctctc
caatattttaacccaaaatgcttagaccttatgcctgaagaggtcaaaaacaaaattatc
aaagctctgaacctcctaaatattttaaaccttaactatgagccaaacgaggaacataaa
gaagtcacttctaccctacttaaaaaccttaaaaaaggactttcctcgcaagctaccagc
ctgatagtagaagcaggttatctgcgtaaatttttaggctaa

DBGET integrated database retrieval system