KEGG   Thermobacillus composti: Theco_0277Help
Entry
Theco_0277        CDS       T02394                                 

Definition
(GenBank) translation elongation factor TU
  KO
K02358  
elongation factor Tu
Organism
tco  Thermobacillus composti
Brite
Translation factors [BR:tco03012]
 Eukaryotic Type
  Elongation factors
   Theco_0277
 Prokaryotic Type
   Theco_0277
Mitochondrial biogenesis [BR:tco03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Theco_0277
Exosome [BR:tco04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Theco_0277
  Exosomal proteins of breast cancer cells
   Theco_0277
  Exosomal proteins of colorectal cancer cells
   Theco_0277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
306783..307976
Genome map
AA seq 397 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITTVLSKKYGGGAAVAYDQIDKAPEERER
GITISTAHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREH
ILLSRQVGVPYIVVFLNKCDMVEDEELLELVEMEVRDLLSEYEFPGDDTPIIRGSAREAL
ENPDGPWADKIVELFEAIDSYIPTPERDVDKPFLMPVEDVFTITGRGTVATGRVERGTVK
VGDEVEIVGLQDETKKTVVTGVEMFRKLLDQAQAGDNIGALLRGVERKEIERGQVLVKPG
SVNPHTKFTAQVYVLTKEEGGRHKPFFTGYRPQFYFRTTDVTGVIELPEGTEMVMPGDNV
TLTVELIAPIAIEEGTRFAIREGGRTVGAGAVASILK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggctaaattcgaacgtacgaaaccgcacgtcaacatcggcaccatcggtcac
gtcgaccatggtaagacgacgctgacggccgccatcacgacggttctgtcgaagaagtat
ggcggcggcgctgcagtcgcttacgaccaaatcgacaaggctccggaagagcgcgagcgc
ggcatcacgatctcgaccgcacacgtcgagtacgaaacgccgaaccgccactatgcgcac
gttgactgcccgggccacgccgactacgtcaagaacatgatcacgggtgcagctcagatg
gacggcgcaatcctcgtcgtatccgctgctgacggcccgatgccgcaaacgcgcgagcac
atcctgctctcccgtcaggtcggcgttccgtacatcgtcgtattcctgaacaagtgcgac
atggttgaagacgaagagctgctcgaactcgttgaaatggaagttcgcgacctgctgagc
gaatacgagttcccgggcgacgacacgccgatcatccgcggttccgctcgcgaagcgctc
gaaaatccggacggtccgtgggctgacaagatcgttgaactgttcgaagcgatcgactcc
tacatcccgacgccggaacgcgacgtcgacaagccgttcctcatgccggtcgaagacgta
ttcacgatcaccggccgcggtacggttgcaacgggccgcgtcgagcgcggtacggttaaa
gtcggcgacgaagttgaaatcgtcggtctgcaagacgaaacgaagaaaacggtcgttacg
ggcgttgaaatgttccgtaagctgctcgaccaagcgcaagccggcgacaacatcggcgcg
ctgctccgcggcgtagagcgcaaggaaatcgagcgcggccaagttctggttaaaccgggc
tcggttaacccgcacacgaaattcacggctcaagtttacgtcctgacgaaggaagaaggc
ggccgccacaaaccgttcttcacgggctaccgtccgcaattctacttccggacgacggac
gtaacgggcgttatcgaactgccggaaggcaccgagatggttatgccgggcgacaacgtc
accctgacggttgaactgatcgctccgatcgctatcgaagaaggtacgcgcttcgctatc
cgcgaaggcggccgtacggtaggcgcaggtgccgttgcttcgatcctgaagtaa

DBGET integrated database retrieval system